CAZyme Information: MGYG000004621_01020

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella
• CAZyme ID: MGYG000004621_01020
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		44226.87	5.0275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004621	2838817	MAG	France	Europe

• Gene Location: Start: 20149; End: 21321 Strand: +

Full Sequence      

MVIALSCMAVCSACSDIDKIEPAPSTIEIPSGDVRNLALADKDATAETKALYANLWQIQQ
RGFMFGHHDDLTYGRYWQYEDGRSDTKEVCGDYPGVYGVDLAEAMDDRAESQKAVNEIKR
RCIIEARQRGMVILACAHLNNPLTGGDSWDNSNKETVKAILTNGSDTQKKFNSWLDRLVA
FAKSLNDAQGHPIPMIFRPFHEHTQGWAWWGNQCTTEQEYISLWHYTADYLRNAGIHQFI
YAISPQMDSPKTEDDFLYRWPGDEYVDFIGMDCYNNGIATTLSVNMRMMQSVAAKKKKPC
GVTETGVEAFTDTKYWTQKILAPAEGRKISMIVTWRNKFVNGDETDKHYFSVYPGHPSAD
DFMLFYSSPQTLFCKDLPDMYAMPADMTVN

Enzyme Prediction     

No EC number prediction in MGYG000004621_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	41	349	6.2e-62	0.9471947194719472

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.63e-30	41	279	2	235	Glycosyl hydrolase family 26.
COG4124	ManB2	3.70e-13	148	312	143	302	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88729.1	3.46e-181	11	390	15	390
ALJ60278.1	2.82e-180	11	390	15	390
ADB80106.1	8.52e-160	14	390	17	388
BBL06287.1	6.03e-152	37	390	78	436
QGT72560.1	9.46e-151	13	390	18	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	2.51e-81	43	383	7	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX5_A	2.99e-72	38	381	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	2.99e-72	38	381	32	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	5.60e-72	38	381	55	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.34e-71	38	381	32	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	8.41e-49	39	384	49	418	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.30e-33	39	390	42	412	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	8.72e-14	87	274	80	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	2.88e-11	39	316	146	422	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	4.46e-10	17	344	154	454	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000025	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004621_01020.