CAZyme Information: MGYG000004622_00067

Basic Information

• Species: Prevotella sp900316565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900316565
• CAZyme ID: MGYG000004622_00067
• CAZy Family: GH67
• CAZyme Description: Extracellular xylan exo-alpha-(1->2)-glucuronosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
635	MGYG000004622_1|CGC2	72791.23	6.547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004622	2570641	MAG	France	Europe

• Gene Location: Start: 84121; End: 86028 Strand: +

Full Sequence      

MRRILTTFLITIFCLAAYCTDGHNLWLGDFLDFNPRQMEIYWTADSFSFAVDKTLSHDGY
TIHGKTVRAGSNIGLLYAQYELMRQKKTGHFHDTTSEPSFKYRVLDHWDNLDGTIERGYA
GRSIFWATGLSRKQWLDRIEEYARADASVGINGAVLNNVNASPNVLTAVYLDSVRMIADV
LRPYGVRVYLSVNFASPKVLGATKTADPFDALVVAWWSRKVKEIYAKIPDFGGFLVKANS
EGQPGPFDYGRSHADGANMLAAALKPFGGIVMWRSFVYGAGHKGEDRVKQAVSEFKDLDG
KFADNVVLQSKNGPLDFQPREPYAPIFDNMPKTTQWVELQVTQEYTGQSRHLVYLAPMWK
EFFSFVSPNRLRGVAGVSNVGNTGNWCGHPFSAANWYAFGRLAWSPELSSREIAQEWLLM
TFEESANRYFLNSMTSVMERSREMCVDYMMPLGLHHIFKFDHHYGPEPDGYRPDYPLEWC
PVYYHKADSIGVGFDRTTDGSDAVSQYREPYRSEYNSLKTCPEQYLLWFHHVPWTYRMKN
GKTLWQNLCAHYERGVTMVETTLFSWKLMHSLFTDNGDEERWRQVESLLMEQLGNATEWK
DVCLTYFQQFSRMPVEESGTSYEPDIAVGLQNGVR

Enzyme Prediction     

EC	3.2.1.139	3.2.1.131	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH67	50	617	3e-239	0.8789237668161435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3661	AguA2	0.0	43	622	79	682	Alpha-glucuronidase [Carbohydrate transport and metabolism].
pfam07488	Glyco_hydro_67M	0.0	82	382	1	321	Glycosyl hydrolase family 67 middle domain. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the central catalytic domain of alpha-glucuronidase.
pfam07477	Glyco_hydro_67C	9.29e-114	387	617	1	220	Glycosyl hydrolase family 67 C-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the C terminal region of alpha-glucuronidase which is mainly alpha-helical. It wraps around the catalytic domain (pfam07488), making additional interactions both with the N-terminal domain (pfam03648) of its parent monomer and also forming the majority of the dimer-surface with the equivalent C-terminal domain of the other monomer of the dimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85458.1	5.61e-285	1	624	1	637
QNT67391.1	1.80e-279	20	617	21	668
ADI70674.1	1.69e-277	1	616	1	629
VEH16569.1	3.87e-276	1	624	1	637
AGB29054.1	9.95e-267	1	616	1	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQI_A	1.67e-175	63	626	108	682	Structureof Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQI_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase [Cellvibrio japonicus],1GQJ_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQJ_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with xylobiose [Cellvibrio japonicus],1GQK_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQK_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid [Cellvibrio japonicus],1GQL_A Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus],1GQL_B Structure of Pseudomonas cellulosa alpha-D-glucuronidase complexed with glucuronic acid and xylotriose [Cellvibrio japonicus]
1H41_A	1.34e-174	63	626	108	682	Pseudomonascellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus],1H41_B Pseudomonas cellulosa E292A alpha-D-glucuronidase mutant complexed with aldotriuronic acid [Cellvibrio japonicus]
1MQP_A	2.58e-155	22	611	64	667	TheCrystal Structure Of Alpha-D-Glucuronidase From Bacillus Stearothermophilus T-6 [Geobacillus stearothermophilus]
1K9D_A	5.15e-155	22	611	64	667	The1.7 A crystal structure of alpha-D-glucuronidase, a family-67 glycoside hydrolase from Bacillus stearothermophilus T-1 [Geobacillus stearothermophilus],1L8N_A The 1.5A crystal structure of alpha-D-glucuronidase from Bacillus stearothermophilus T-1, complexed with 4-O-methyl-glucuronic acid and xylotriose [Geobacillus stearothermophilus],1MQQ_A THE CRYSTAL STRUCTURE OF ALPHA-D-GLUCURONIDASE FROM BACILLUS STEAROTHERMOPHILUS T-1 COMPLEXED WITH GLUCURONIC ACID [Geobacillus stearothermophilus]
1MQR_A	7.28e-155	22	611	64	667	ChainA, ALPHA-D-GLUCURONIDASE [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3PC73	1.93e-174	63	626	132	706	Extracellular xylan exo-alpha-(1->2)-glucuronosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=gla67A PE=1 SV=1
Q09LY5	1.41e-154	22	611	64	667	Xylan alpha-(1->2)-glucuronosidase OS=Geobacillus stearothermophilus OX=1422 GN=aguA PE=1 SV=1
P96105	1.36e-153	62	622	103	673	Xylan alpha-(1->2)-glucuronosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=aguA PE=1 SV=2
A1DD80	3.75e-139	55	624	110	697	Probable alpha-glucuronidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=aguA PE=3 SV=1
Q4WW45	7.42e-139	71	624	130	697	Probable alpha-glucuronidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=aguA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000376	0.998711	0.000353	0.000189	0.000174	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004622_00067.