CAZyme Information: MGYG000004622_00072

Basic Information

• Species: Prevotella sp900316565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900316565
• CAZyme ID: MGYG000004622_00072
• CAZy Family: CBM4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
807	MGYG000004622_1|CGC2	89173.31	4.625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004622	2570641	MAG	France	Europe

• Gene Location: Start: 94471; End: 96894 Strand: +

Full Sequence      

MKIHHIIIPVLASAMLMSSCDDQIMEWGKPAGEGEVTSADIPLAVKEALANYEPVKSYAS
QYTPNMVVGLGLSAAMYNESAASGTAYSTLANENFQMFTPGNALKMDAIVGNSGAQNFST
VDKMLDNMPNDVRLYGHNFIWYQQQSQTYLKSLIAPTMVIKTEGDIASVLKNGYFDSDII
GWSGWGNNSSREWMAEKDGQTGVVHLTNPKDANKWDAQFCQDLDPSLKSGTTYTLRFKAK
CSVGNGIIQNCVQNSKTYSGQAYHDFNVGKDWQTFEYEITPNNDDMNRLCFNFGAVAAEY
WIDEIQFGVKKEDPMENVLTGDNSDFEGGTKGSWGSWGGSSSSEVKKGAGRDGSYGLVLV
NPNDGDFWNTQCAIDFDTPLDETKTYMIQFYAKSNTAAGALQFQYQNSSTYGSQGAYSVF
QVGKEWVLCEKTFKPAYDDVNRILINFGKVAGEYQIDNIKFGVAKNQGESAAKQFILVRR
AGRRTRGGTTITYTIKSPEEKRTALLGAMEGWIKGVADHLAEKNVVPYGYDVINEPITDG
TNKVRGVDNDAFGGSTTDDDGNTTYDKAPEESTTDGLNLNWGNNRFYWGYYVKDYAVRAF
QYARKYLPAETKLFVNDYNLEVSPGKLSALINFINDIDKANGTPIVDGIGSQVHFDLKAA
TDDVATNDSIIKVLKGRVDQMFKTMAATGKLIRVTELDVALGTSSPSAAQYKCQSDCYKM
IFESYKENVPEAQQSGITIWGLSDNADEHEYWLKGDVPNIFDANYLRKWAYKGVCDGIAG
EDLGLKYGGDDYRAYYEKQNVSSTVSQ

Enzyme Prediction     

No EC number prediction in MGYG000004622_00072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	501	776	2.7e-41	0.6798679867986799
CBM4	169	294	3.8e-18	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	4.14e-35	501	774	54	263	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	5.64e-29	504	776	99	310	Glycosyl hydrolase family 10.
COG3693	XynA	2.13e-24	495	774	113	337	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
pfam02018	CBM_4_9	1.96e-09	167	285	1	121	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
pfam00331	Glyco_hydro_10	2.35e-05	86	144	26	85	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ61540.1	1.79e-220	1	799	1	765
QUT92890.1	7.16e-220	1	799	1	765
EDV05054.1	1.26e-200	1	807	1	782
QDO69424.1	1.01e-199	1	807	1	782
QCP72441.1	6.62e-160	11	801	13	792

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F8Q_A	8.08e-20	499	776	111	353	Analkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27],2F8Q_B An alkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27]
2FGL_A	8.19e-20	499	776	112	354	Analkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27],2FGL_B An alkali thermostable F/10 xylanase from alkalophilic Bacillus sp. NG-27 [Bacillus sp. NG-27]
4QDM_A	8.30e-20	499	776	113	355	Crystalstructure of N-terminal mutant (V1L) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27],4QDM_B Crystal structure of N-terminal mutant (V1L) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27]
5EB8_A	8.30e-20	499	776	113	355	Crystalstructure of aromatic mutant (F4W) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27],5EB8_B Crystal structure of aromatic mutant (F4W) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27]
5EFF_A	8.30e-20	499	776	113	355	Crystalstructure of an aromatic mutant (F4A) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27],5EFF_B Crystal structure of an aromatic mutant (F4A) of an alkali thermostable GH10 xylanase from Bacillus sp. NG-27 [Bacillus sp. NG-27]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07528	1.88e-15	594	776	215	396	Endo-1,4-beta-xylanase A OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=xynA PE=1 SV=1
P29126	6.25e-14	564	774	768	949	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
Q2PGV8	6.12e-12	599	778	185	355	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
P40943	1.09e-11	594	764	207	364	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 PE=1 SV=1
P51584	2.40e-10	528	784	330	545	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004622_00072.