CAZyme Information: MGYG000004622_01049

Basic Information

• Species: Prevotella sp900316565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900316565
• CAZyme ID: MGYG000004622_01049
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000004622_18|CGC1	39656.96	8.3508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004622	2570641	MAG	France	Europe

• Gene Location: Start: 10233; End: 11297 Strand: -

Full Sequence      

MKQLLILLMCLSAVVSVSARGKYDNTDTITVARDGSGEFRNVSEAVEACRAFMEYKKVIY
VKNGTYKEKVVVPSWLTNIEIVGEDRDKTVITYDDHANINLPGTTHHMGTFRTYTVKVEG
TNITFKNITIENNAPKLGQAVALHTEGDRLVFINCRILGNQDTIYTGTPGTRLYFLDCFI
NGTTDFIFGPSVAWFENCELQSRSNSYVTAASTPKDQKFGYIFNHCRLTAEPGVTKVFLG
RPWRAYAYTLFKECTLGSHIVPEGWHNWVDYHDPAKEGIVRYMEYKNNGPGADTKARVAW
SHQLTKKEAAAITLAAVFGDTSWIPTKKHGFVTRDASPPTRSSLGVNNNMNQYS

Enzyme Prediction     

No EC number prediction in MGYG000004622_01049.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	29	317	6.9e-100	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	8.90e-80	29	315	2	292	Pectinesterase.
PLN02773	PLN02773	7.79e-68	29	310	7	288	pectinesterase
PLN02432	PLN02432	2.23e-64	29	324	13	292	putative pectinesterase
PLN02682	PLN02682	2.47e-64	28	326	70	369	pectinesterase family protein
PLN02708	PLN02708	6.78e-62	29	326	243	551	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ81978.1	2.77e-143	1	327	1	324
ADE82952.1	2.77e-143	1	327	1	324
BCS84477.1	5.05e-142	1	326	1	324
QQY41711.1	3.97e-141	1	325	1	314
QQY38333.1	3.97e-141	1	325	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.46e-37	31	324	7	304	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.71e-32	29	324	9	308	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	2.22e-30	29	324	11	295	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.15e-29	29	324	11	295	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NTB_A	4.95e-20	39	326	18	340	Crystalstructure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTB_B Crystal structure of pectin methylesterase in complex with hexasaccharide V [Dickeya dadantii 3937],2NTP_A Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTP_B Crystal structure of pectin methylesterase in complex with hexasaccharide VI [Dickeya dadantii 3937],2NTQ_A Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937],2NTQ_B Crystal structure of pectin methylesterase in complex with hexasaccharide VII [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41510	7.39e-44	28	324	272	573	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q9FJ21	3.19e-43	29	328	260	563	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q42608	1.13e-41	28	324	259	560	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1
Q5MFV6	1.38e-41	28	324	276	577	Probable pectinesterase/pectinesterase inhibitor VGDH2 OS=Arabidopsis thaliana OX=3702 GN=VGDH2 PE=2 SV=2
Q1JPL7	1.82e-41	26	324	244	546	Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana OX=3702 GN=PME18 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999155	0.000174	0.000149	0.000140	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004622_01049.