CAZyme Information: MGYG000004623_01834

Basic Information

• Species: Blautia_A sp900551465
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900551465
• CAZyme ID: MGYG000004623_01834
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000004623_115|CGC1	55448.78	5.1521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004623	3060889	MAG	France	Europe

• Gene Location: Start: 5381; End: 6805 Strand: -

Full Sequence      

MSTLTKVLAEEIRKIEETKFMERDLFPHRLTHHLMPPAGWLNDPNGLCYYKGRYHVFFQY
SPFEVKGGLKFWGHYSSEDLVSWRYEGVPLYPDSPMDCHGVYSGSALAEKDTMHLFYTGN
VKLDGDYDYINNGRITSTIHVESTDGIRFGVKEEVIPASQYPEDYTCHIRDPKVWKEHDQ
YHMVLGGRKKNDQGAVLFYRSEDLKKWEFDGELTTEKPFGYMWECPDVFELDGQKILSVS
PQGVKREKYRYQNIYLSGYFVMKEEKVQAEDFCEWDMGFDFYAPQTFLDQKGRRLLIGWM
GMPDADEEYQNRTLEEGWQHCLTVPRELRYQNGKIYQYPVEELMNLRRWEKKLSQEDREV
EIEGAFDLELQLEKGSVKVVLTDVFTLEHKDGILTLTMNEEAGAGRSSRNACVEQVKDIR
ILADTSAVEIYVNQGEVVFSSRFYGKTPVHTLKIEAEEFRGGFWKLEKMKIIKA

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	33	339	9.3e-97	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.34e-169	39	332	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	7.77e-155	27	444	12	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.00e-149	3	457	7	471	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	1.77e-118	33	435	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	3.30e-118	33	339	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL20909.1	2.22e-243	1	467	1	470
QCU01937.1	3.65e-242	1	467	1	470
QYX26047.1	6.43e-184	1	468	1	469
QNM06260.1	8.30e-174	1	471	1	483
BCN29305.1	1.23e-168	1	470	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7BWB_A	8.70e-77	28	460	48	483	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7VCO_A	3.57e-76	31	470	28	489	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWC_A	1.32e-75	28	460	48	483	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	2.48e-66	27	469	31	488	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	6.62e-60	31	469	5	430	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	1.67e-114	27	466	27	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P13394	9.57e-90	31	444	39	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
Q05936	3.53e-89	28	457	33	476	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P27217	1.26e-88	28	448	26	442	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P37075	3.53e-88	28	444	26	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004623_01834.