CAZyme Information: MGYG000004624_00402

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; CAG-390
• CAZyme ID: MGYG000004624_00402
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	MGYG000004624_36|CGC1	70272.45	5.2735

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004624	1785578	MAG	France	Europe

• Gene Location: Start: 5511; End: 7376 Strand: +

Full Sequence      

MERYSFIPFEQVDLADGFWRDRYEINRTVSIENVKKRFEETGRMDALRFNFLKTGKRPHV
FYDSDVAKWMEAVAYLYSKDRDSMRDNIALCEELIDCMERAQRPDGYLNSAHQQLTPEGI
FMHRSEHELYCAGHLIEAAIAYHKATGRARFLRIMERYCDCIERAFITEKTAAFTTPGHE
EIELALIKLYRHTGKRKYLDMARFFLENRGKAENEKYAQDDNPRGCQDDVDIYDLREANG
HCVRALYYYSGIADLTAETGDERLLANLRSVFDDITGHKMYITGGVGSAYRGEAFTVAYD
LPNFMAYTESCAALAMVFFCTRMRELDSDVRFSHTVERVLFNAALSSTSLDGRSFFYTNP
LEIALEQYGREVGLPEKKRERLPAPERVEVFSCSCCPPNINRFFSEFGGYICLSEDGHLT
VDQYIPSVIHSDLGTVIISGEYTADGKMTIASDDYRAGVIALRVPEWCRRAPVYRLNGSA
ITPDVHNGYAYFNVGRCFTVEADFPIEAAFVAADPMVRADAGRIALTRGPVVYCIEGVDN
GTRLNRISVDPASAASAVIGDGDFCGVPDITLPAFRDTAKAEGLYVSADAIEKEPISARF
IPYFAFANRGKSDMQVWIRRA

Enzyme Prediction     

No EC number prediction in MGYG000004624_00402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	12	534	1.4e-153	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	3.88e-131	7	620	12	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	3.04e-119	11	534	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
cd04792	LanM-like	0.003	131	203	594	677	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS96918.1	2.41e-152	1	617	4	624
QHQ63226.1	3.51e-142	7	617	9	621
AZN43118.1	3.29e-131	1	620	7	656
QNM44926.1	5.10e-130	60	619	66	639
AST94488.1	5.10e-130	60	619	66	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.11e-128	12	618	16	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.01e-122	12	618	16	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	5.26e-103	7	618	10	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WKW_A	3.49e-102	60	621	72	659	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	9.66e-102	60	621	72	659	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.62e-101	60	620	72	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004624_00402.