CAZyme Information: MGYG000004626_00649

Basic Information

• Species: CAG-521 sp900553105
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521; CAG-521 sp900553105
• CAZyme ID: MGYG000004626_00649
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		26980.29	10.2543

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004626	1754327	MAG	Germany	Europe

• Gene Location: Start: 122771; End: 123481 Strand: +

Full Sequence      

MAIFNTKAKHLFKRGLIVAGAAFCLIEIYYIGQVLYYSKAEITTSAYIESERERLGKVTV
RPVPLLRVSNNMIRAVIAAEDVNFLDHNGIEWKALQTAFISNVLEGEAAPGGSTITQQLI
KNLFLSHKKSYIRKAQEIVLAKVMEATWSKGRILQTYLNVAEFGQGIFGVEAAAQHYYGQ
RASTLNHWQSLWLACILSNPRYYEKRGSTRWLEIRMRRVSRAMTFPEVYRVNNRLQ

Enzyme Prediction     

No EC number prediction in MGYG000004626_00649.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	59	223	1e-55	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.58e-74	11	223	4	223	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
pfam00912	Transgly	1.29e-63	61	224	14	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02070	mono_pep_trsgly	1.47e-55	21	221	9	223	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.92e-55	61	223	77	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.18e-39	62	218	69	232	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ97963.1	1.65e-64	13	228	15	235
ANU66032.1	1.70e-64	13	228	16	236
AWL05996.1	1.67e-53	25	228	28	237
QCP11807.1	1.30e-52	17	228	19	236
QYF99730.1	7.56e-52	25	228	28	237

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	7.02e-28	63	229	23	194	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.74e-27	63	229	23	194	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	7.96e-23	41	203	18	182	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	8.06e-23	62	210	42	195	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3UDF_A	8.94e-22	56	203	36	182	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2KUU2	2.90e-50	21	228	19	239	Biosynthetic peptidoglycan transglycosylase OS=Bordetella avium (strain 197N) OX=360910 GN=mtgA PE=3 SV=1
A4G8N2	7.11e-49	63	228	65	230	Biosynthetic peptidoglycan transglycosylase OS=Herminiimonas arsenicoxydans OX=204773 GN=mtgA PE=3 SV=1
Q3SFZ8	7.32e-49	14	223	10	225	Biosynthetic peptidoglycan transglycosylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=mtgA PE=3 SV=1
Q7W3V2	2.76e-48	25	228	28	241	Biosynthetic peptidoglycan transglycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=mtgA PE=3 SV=1
Q7W039	2.76e-48	25	228	28	241	Biosynthetic peptidoglycan transglycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=mtgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37