CAZyme Information: MGYG000004632_00364

Basic Information

• Species: Prevotella sp002300055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002300055
• CAZyme ID: MGYG000004632_00364
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381	MGYG000004632_3|CGC3	44159.21	9.2328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004632	2937832	MAG	Germany	Europe

• Gene Location: Start: 85589; End: 86734 Strand: -

Full Sequence      

MRKIILTAFVALAALGAQAKGWTQEQVDATIVKVNNYWQQHNKAEVRSFWDNAAYHTGNM
EAYKLLGKTEWIDYSTRWAEHNKWMGATETDPAKWKYRHYGEGHQFVLFGDWQICFQTYI
DLYWIANAKGASARNERMVQRAKEVMGYEAYSKQNDYWWWADALYMVMPVMTKMYKLTGD
SQYLDKLYENLLYADSIMLDEETGLYFRDGKYIYPKHKTASGKKDFWARGDGWVLAGLAK
VLQDMPADYAHRDFFVKKYQRLAAGVQKLQQKQGYWTRSMMDPTFAPGPETSGTAFFTYG
YLWGVNNGLLDAKQYRKTIDRAWKYLTETALQPDGKVGYVQPIGEKAIPGQVVDKNSQAN
FGVGAFLLAACEYHRYLDKQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	375	4.1e-75	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.47e-83	30	377	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.64e-36	58	375	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28481.1	1.90e-220	1	379	1	380
QVJ79822.1	5.35e-204	1	379	1	371
ADE82673.1	1.53e-203	1	379	1	371
BCS84432.1	4.24e-197	24	379	7	365
QQY40390.1	4.77e-182	1	378	5	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	6.62e-171	1	378	1	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.17e-142	23	378	12	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.99e-54	22	372	24	365	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	9.73e-13	134	372	104	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.99e-12	134	372	94	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.30e-53	22	372	31	372	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.58e-50	158	372	157	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	1.14e-46	158	372	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	5.33e-12	134	372	104	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.999009	0.000196	0.000173	0.000174	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004632_00364.