CAZyme Information: MGYG000004632_01138

Basic Information

• Species: Prevotella sp002300055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002300055
• CAZyme ID: MGYG000004632_01138
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000004632_13|CGC1	54363.28	5.1581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004632	2937832	MAG	Germany	Europe

• Gene Location: Start: 2715; End: 4154 Strand: -

Full Sequence      

MHHLIDCFLPCSTQEENERNQQCLQQDIVNEVNFLSSSMTESATWKAIAAKAKAPYSLVY
LNRQFIQLGYLALERMVNVAEMTGAGMLYADHYKLTADGRRLEAPTIDYQQGSLRDDFNF
GSVVLLKTTALQEAAQRITADYQAAGFYDLRLKLSEAQMLVHVNEYLYSEVELDTRKTGE
RLFDYVDPKNRQSQVEMEQACTEHLKAVGAYLAPGAYKPMRVDEGAFPVEASIMIPVRNR
IRTIKDALTSALNQKTSFAYNVFVVENGPECHSTDGTTELVEEMARADERIVHIVTDRRD
LGVGGSWNLAAHDPRCGRFVAQLDSDDVYADENTLQKIVDAFHEQQCAMLIGAYTLTDIH
LNVLPPGVIAHKEWTPENGRNNALRINGLGAPRSFYTPVLREINLPNTNYGEDYALGLAI
SRDYMIGRLYDPIYNCRRWDDNSDGDLSIEKENRNNVYKDRMRTWELMARIAKNRKNQA

Enzyme Prediction     

No EC number prediction in MGYG000004632_01138.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	232	356	3.1e-16	0.6882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	2.65e-15	233	345	1	105	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.06e-15	232	395	1	156	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	3.23e-12	232	343	6	108	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02525	Succinoglycan_BP_ExoA	5.71e-11	232	356	3	120	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd06433	GT_2_WfgS_like	3.67e-09	232	377	1	134	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28090.1	1.41e-245	1	471	1	469
QRQ49032.1	6.89e-206	5	477	4	486
QUT44740.1	4.25e-205	5	478	4	487
QUT33541.1	7.97e-205	5	476	4	485
QPH58388.1	7.97e-205	5	476	4	485

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004632_01138.