CAZyme Information: MGYG000004632_01155

Basic Information

• Species: Prevotella sp002300055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002300055
• CAZyme ID: MGYG000004632_01155
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		54397.66	6.9279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004632	2937832	MAG	Germany	Europe

• Gene Location: Start: 29570; End: 31009 Strand: +

Full Sequence      

MKSIRIAFISVLCLLGTLPLSAQPSNTIEGTVNLSALRQRHEGWGVSLCWWANMCGKWDE
EKVDELVDWLVSPNGLNFNIFRYNIGGGEDPLNRNCDLHHMGRGKGLRAEMEGFKDSTNG
DYIWTRDLAQRRIMLKIKQKRPDAIFEAFSNSCPYYMTYSGCVGGNDDPNKDNLRPEYYE
EFAHYLVDVCKHYKDVYGIEFKTLDPFNEPMTDYWNRNGSQEGCHFDFESQIAFLRVLSP
ILKASGLKTVISASDETEVATSAKGIKAYQEAGVLDLVGQWNVHTYKADNESRKIVNQVA
RGAGKMLWMSEVGAGGRGIDGNLRLAQTLFDDERYIQPDAWIDWQYAAERDDQWCMIDCD
FGKQTYRKVKHYSVRQQVSKFIKVGYTFVDTSLPSTLAAISPDKKQLVLVALNLSKEPQS
YSINLLNGRAQPTKGQGYITTRTQDVEPCDFQSENKRNLHFNMPAKSIMTIVVPVKTNK

Enzyme Prediction     

No EC number prediction in MGYG000004632_01155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	31	471	1.1e-129	0.9956140350877193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.44e-26	32	299	6	248	O-Glycosyl hydrolase family 30.
COG5520	XynC	1.47e-11	107	473	83	428	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE17217.1	1.05e-156	31	473	33	476
AEW47939.1	9.34e-149	1	475	1	485
AEW47948.1	9.34e-149	1	475	1	485
ADF52950.1	3.87e-128	28	472	24	468
CAN91123.1	3.68e-103	32	475	108	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	3.76e-14	32	473	10	496	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	5.21e-43	22	435	20	430	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
A0A401ETL2	1.17e-19	42	349	50	446	Exo-beta-1,6-galactobiohydrolase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=bl1,6Gal PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000308	0.998998	0.000181	0.000172	0.000156	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004632_01155.