CAZyme Information: MGYG000004632_01290

Basic Information

• Species: Prevotella sp002300055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002300055
• CAZyme ID: MGYG000004632_01290
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	MGYG000004632_16|CGC1	60868.9	9.7099

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004632	2937832	MAG	Germany	Europe

• Gene Location: Start: 15836; End: 17479 Strand: +

Full Sequence      

MIFTLVTFFANTGALPTDIMEERNVVTAREMVSDGNWLVPTMNGQLRLEKPPLPTWVAGA
IEAVCPNNLGAQRLAAGAMGCLWTWFLFLTARYIARRTDYAIIATVVFLTCYNTVLMGRS
ATWDIYCHALMMGAIYLLLRALNEERDYRWQLPLAGLFLGLSWLSKGPVSFYTLLLPFLL
SIVTLPSITTRGKWPYLGIMLGVAVVVGGWWYAYLLIMHGDAVTAVMAKETGAWTNHNVR
PWWYYWRFFLEMGAWALPALASLALTYWKHHITIKRTYLITFCWTVGSLVLLSLMPEKKM
RYLLPSLAPCALLVACILTHLKDTLASGKADRFVRTLFVAQSVLLILVMLGSAVALFGLH
AASVISVPMRLIAAALLSFAACDTMRAVASRQPMVQVRAVAIVFATAELLLLPAITKAVG
NPDSHSIALAVGTPQTQELPLFHDQRTPIRIELVYNAQRKIQPIDLNDVKEVRAHMPFAL
VITASAKAPIPTTLLAEADTCPLGYFDNNLHRHSNRHYTDDLRGRVLLIKGKQANNPSSQ
ANIKQTR

Enzyme Prediction     

No EC number prediction in MGYG000004632_01290.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	2	409	7.9e-60	0.7666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.22e-24	2	413	16	426	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.63e-10	50	212	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	4.52e-08	28	368	40	375	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1928	PMT1	0.001	35	194	76	245	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	0.003	86	219	99	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANA39794.1	4.27e-17	2	320	13	330
BBA70984.1	5.68e-17	2	320	13	330
AAR35928.2	1.00e-16	2	320	13	330
ADI85313.1	1.00e-16	2	320	13	330
AJY68843.1	1.00e-16	2	320	13	330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WAM1	9.00e-12	21	351	32	365	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
Q6D2F3	3.67e-11	21	321	35	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C6DAW3	4.85e-11	21	335	35	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
A8FRR0	1.03e-09	21	315	34	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
Q2NWA9	1.39e-09	21	331	34	347	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.574894	0.424206	0.000243	0.000298	0.000172	0.000190

TMHMM  Annotations     

start	end
75	94
101	123
167	189
196	218
243	265
278	297
302	321
333	355
359	381
394	416