CAZyme Information: MGYG000004632_01741

Basic Information

• Species: Prevotella sp002300055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002300055
• CAZyme ID: MGYG000004632_01741
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
945	MGYG000004632_28|CGC1	106334.81	6.1972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004632	2937832	MAG	Germany	Europe

• Gene Location: Start: 25934; End: 28771 Strand: -

Full Sequence      

MMNYLKKVSLLLLCSLFVQVASWAQQVQVSPVPQSVSWGEKAFESANAKYSLTKAETTDA
YAVALLQEKLTLADDGISLVVGKKGEAAVSAVEANIPETAEGYYLKVDANGIIVAGADDA
GTYYGVQTLLQILAQPNVMEVEISDYPACAQRGVIEGFYGNPWSDADRKSQFEFYGKNKM
NIYVYGPKDDPYHRTKWRENYPADKAAIIRGLAEAAKKNHVSFVWSIHTGGSISNSESDF
KAVVNKLEHVYSLGVRNFSIFFDDFGGADASLQVAECNYVWKNFIEKHDDLNRLSMCPTK
YNAAYAGWNKNDDYLRALGKGLHKGIEVMWTGDGVADMINQGDLDFFKTATGGMAPFIWL
NYPVNDYCIGHMLMGKFYGNDKGNNAFGGKMTAFTSNPMEYAEASKVALYGVADYAWNMK
DYNPEANWERAIRYLMPNNAEAFHVFCEHNVDLGWTVHGLRREGESPNFNVNGTLDEQKD
QFDLMVEAADALLADTYNPALITEITPWLQKMKYMGQRGQKIVEMWGLIDSGDTAKFLQD
YRDIQDLLTKEDALISRNFSGTIKSAKPVVATQKVEPFLKQQLNELVIAYKSKYTEGWEN
FPVQVLETGNYYIKYNGKYLYNKNASADRTGDMPIWTDAIDDTQPQKCEWTISVDPNTGR
YKIANTQDGRYLNEKGQFWENKEINPYDPEWHSYDIYRVNGKYAIQTTAKVSRKFLGANK
TRIIKRDTPLAKDKDNNPILHINDAIFEIVPVKGNDGKHPVIESGKTYYIKNDKGEYLTT
TSSLSALSRPTFKAKGKDVTKQKYQKWTITTDATSGRWKIAFNKNKFLDEEGRINQNPYY
SEWNSVILREVGGKWAMTSVTPNAAPQQWGITTDKVIKRVDADLKDSYVFTVVDVDDDDL
ATGISTPTTSNDTNANAAIYDLFGRKVEKPAQHGVYIKGGKKFVK

Enzyme Prediction     

No EC number prediction in MGYG000004632_01741.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	152	447	4.8e-97	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	7.70e-148	152	446	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	7.39e-18	28	145	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam14200	RicinB_lectin_2	0.003	603	673	7	74	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13183.1	1.37e-207	20	754	18	737
QUB43766.1	3.14e-144	81	672	73	669
QRO48327.1	1.02e-136	5	585	1	592
AZS29316.1	1.49e-135	5	560	1	567
BCA48935.1	2.08e-125	12	594	13	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	4.10e-126	12	594	13	601	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	2.21e-125	12	594	13	601	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	2.21e-125	12	594	13	601	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	7.29e-125	24	594	3	583	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2CHO_A	9.41e-125	25	594	1	580	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	2.24e-125	12	594	13	601	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	6.98e-80	29	712	46	764	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	1.31e-79	29	712	46	764	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	1.01e-44	28	441	40	489	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	2.02e-27	153	415	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000360	0.998904	0.000213	0.000175	0.000168	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004632_01741.