CAZyme Information: MGYG000004633_00710

Basic Information

• Species: Erysipelatoclostridium sp002160495
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium sp002160495
• CAZyme ID: MGYG000004633_00710
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
201	MGYG000004633_17|CGC1	23492.84	4.7274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004633	2814686	MAG	Germany	Europe

• Gene Location: Start: 10162; End: 10767 Strand: -

Full Sequence      

MKKIIFRLFVIIILIALIFCGFYAYQGYKVYQDVIEEKNIEQRVAELQNKEDYVKLDEIA
DVYVELVVESEDHRFYQHHGVDYIGLTRAMLTNLATWSYKEGGSTITQQLAKNLCLSFEK
SLDRKFAEVFIAWQLERDYSKDEILEMYLNITYLGEGNYGIKAASNYYYNVEPSQLTKEQ
AEVLVRTLKSPSVYNPSIINE

Enzyme Prediction     

No EC number prediction in MGYG000004633_00710.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	45	197	1.9e-59	0.864406779661017

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	4.95e-70	48	196	10	158	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	7.86e-66	2	196	12	222	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.47e-57	1	196	1	212	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	4.88e-56	53	196	4	147	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK13481	PRK13481	3.35e-42	2	195	5	195	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY26839.1	8.13e-96	1	201	1	201
QQV06180.1	8.13e-96	1	201	1	201
QMW75367.1	8.13e-96	1	201	1	201
QPS14297.1	8.13e-96	1	201	1	201
BCL58218.1	2.27e-83	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.41e-34	53	196	22	165	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.00e-34	53	196	22	165	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	9.20e-30	44	201	50	213	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.07e-29	44	201	14	177	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.09e-29	44	201	15	178	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	3.25e-37	15	196	28	212	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P39793	2.71e-36	31	196	75	241	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
O87579	1.25e-33	48	198	65	215	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
Q4L7I0	1.59e-33	2	201	40	236	Monofunctional glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=mgt PE=3 SV=1
P0A0Z6	5.87e-33	48	198	65	215	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.742687	0.042173	0.210178	0.000361	0.000180	0.004426

TMHMM  Annotations     

start	end
5	27