CAZyme Information: MGYG000004633_02090

Basic Information

• Species: Erysipelatoclostridium sp002160495
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium sp002160495
• CAZyme ID: MGYG000004633_02090
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773	MGYG000004633_103|CGC1	88331.27	5.9759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004633	2814686	MAG	Germany	Europe

• Gene Location: Start: 3698; End: 6019 Strand: +

Full Sequence      

MDRESVASNTNLDRERDFAEFRPSKYIRIPFESKKAIKKARVYMTAHGIYQFYVNGVRYD
NREFAPENTSYHKLLQYQTYDITPLLQMGKNVFGIIIGDGWWCGRVGTTGDSCQYGNKLG
LLFESVITYHDGSKQIITGSQGKSMSGPIIFSDLFVGEKYDARKELSGWLKTDYDDSNWD
EVKEVDYPIDNLVGQSSEPVRIINSFKPKRIIKTPANETVIDAGKIVAGFVEFSLTAKAG
IEIKLEHSEVLDTNGNYYNNILGTNKEQTDIYITKDGFQTFRPHFTYHGFRYIRITNWPQ
TISLDDFKINVISSDMESISSFKTNNQLINQLQHNIVSSQVANSISIPTDCPQREKAGWT
GDIMAYAPTMCFNSNAHSFLRSWMNNVRVDQLKNGEIPVVVPYLKAYEIFIKGMTGFETS
CGWGDAVLTVPYAIYEAYGDKQVLIDNYDAMKKWMNYIEERMHNHHPKDYDTYDQARKKR
SYYLWNTDFHFGDWLIPSLVLNNPDGGAMMDTAYATMEIVAPAYAAFSCQYMAKIATILK
KEDDSQKYKQLYDKIRQAFIEEYVHEDGTIDADFQGIYVIALKNNLVSETVRPKMVEHLC
KLIKDNNNCLDTGFLSVLFLMDVLCENGKRDVAYQLLFQTKCPSWLYMVEHGATSIWESW
GAIGEDGTVSTYSYNHYAFGCIGDWMYRELGGLQIIEPGYKKFKVAPALDCGLEFVSIQE
NSPYGKIKIDWQRIKNQIIVHVTVPVNTTADIVLPNFVKKDVGSGNYTFVITI

Enzyme Prediction     

No EC number prediction in MGYG000004633_02090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	211	754	9.4e-154	0.998015873015873
CBM67	25	187	3e-29	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.38e-101	320	688	4	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.46e-59	35	204	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.09e-25	212	313	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	4.16e-16	692	769	1	78	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI36516.1	1.14e-261	17	755	154	896
AYA78378.1	3.39e-248	23	755	157	884
QKS44705.1	6.23e-242	23	754	164	897
ABF44215.1	4.94e-235	27	773	165	931
QIG39450.1	1.11e-192	19	755	148	896

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	6.88e-134	35	771	314	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	2.10e-126	19	769	127	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.82e-116	31	760	183	904	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.83e-133	35	771	314	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	7.89e-120	26	768	176	894	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.57e-106	26	755	172	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.33e-73	26	754	186	906	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004633_02090.