CAZyme Information: MGYG000004633_02500

Basic Information

• Species: Erysipelatoclostridium sp002160495
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium sp002160495
• CAZyme ID: MGYG000004633_02500
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		42728.07	8.0068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004633	2814686	MAG	Germany	Europe

• Gene Location: Start: 1581; End: 2666 Strand: +

Full Sequence      

MKIAIVPFHSGLANDILFDKDNESTNSDDLITPYYYIKQEYEKRGVSINTLDQYNTLDSL
DCVLFFKLDYNELIRCIKSKVKRLYYFAWEPEVVDNHHSKKNLAKLEPFFNVIFTWNDDI
VDGNKYLKINYPYHFTNVIECPTRENFEKRNLLVNISGNKISFQHNELYSVRRKVISFYN
KYSCTYFSLYGRGWLKNLRVYKGVCISKKKVYAQFKFALCLENMCNVNGYVTEKIFDCFT
AGIVPVYWGASNIEKYIPKQCFISYTDFSSIDDLNHFLINMSYEEYCNYICHIKEYLQSS
AKSVFEYKYFMRQLDSALISNIERECNNEVALAFYSILQNISRKPKALFNLTTKLIVDYC
M

Enzyme Prediction     

No EC number prediction in MGYG000004633_02500.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	50	305	1.4e-33	0.7262247838616714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	1.54e-07	213	310	54	134	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ43443.1	1.47e-129	1	314	1	313
QCQ48039.1	1.47e-129	1	314	1	313
QLK80746.1	1.52e-129	1	314	2	314
QTL97700.1	4.25e-78	2	324	3	325
QGP65707.1	1.27e-60	3	329	4	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.20e-09	207	273	224	289	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.38e-09	207	273	224	289	CrystalStructure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30511	8.42e-09	207	273	224	289	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
Q9C8W3	5.38e-08	213	274	283	343	Alpha-(1,4)-fucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=FUT13 PE=2 SV=2
O88819	4.73e-06	216	278	239	302	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
Q99JB3	4.73e-06	216	278	239	302	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
Q9LJK1	6.04e-06	206	283	254	328	Glycoprotein 3-alpha-L-fucosyltransferase A OS=Arabidopsis thaliana OX=3702 GN=FUT11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999911	0.000122	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004633_02500.