CAZyme Information: MGYG000004634_00972

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; CAG-274; UMGS1441
• CAZyme ID: MGYG000004634_00972
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
937		102455.5	5.1273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004634	2025534	MAG	Germany	Europe

• Gene Location: Start: 3326; End: 6139 Strand: +

Full Sequence      

MNPPDNKGEDLGGTKILTDIPNYKKNIEREKKKVNSRDEMASDREGIRDDSSAKRHSSER
NVMKKKTSDSSHSHNHSLGNGKKKKKKERSKPFSVFLTALMMLAIMLGFAVCGGLVGAYV
GIINSIPELGVVNIKPGTYTSIIYDDNGTEVSKLHGGENREYVSLDQIPEYMQQAVIAIE
DERFYDHNGVDIQGFARAIYSTATGKQMQGGSTITQQLIKNNVTKVTRNTPKTKIKEQYL
ALMYEKKLKEAYGSKEAAKNYILELYLNTIALGHGYSGVKTAAEGYFGKEPSQLSLAECA
CLAGITNNPSLYSPRTQPENNRRRQTIILNYMLTQGRITQEEYNQAINEDIYANIRETDS
INDSQKQNDTVIHSYYEDALVEQISKDLQNKYNWSVEEANNVIYNGGLQIYSNLDQNIQN
IVDAEYNDDNNFPNVYYCIDVDYRVSVEDKTTGEQTHSQYNTFARSRAGAEAWVADKKAE
IENGLGENEEIAAESVYYNKQPQSAMVIIDYHTGEVKAIAGGRGEKTVNRGFNRATDSAR
QPGSVFKVLAAYAPAVDLGKVTNATTIVDEPYETADGYAPKNWWGNSYRGAVNARTGIKN
SMNIVAVKIMVETGIDLCYNYLLNFGFTTLENDNHAATALGGLTNGVTQLEVAAAYGTIA
NQGQYIKPCFYDKVLDHDGNVLLENTKETKQVLKSSTGYILTEMMTDTIKSGTGTKANLG
EMPVAGKTGTTTDSKDLTFVGYTPYYVCSIWLGYDRYDSNVKNMNNVNQSQHLVMWRDVM
SKIHENLEVKDFEMPDTVEKATVCKISGKLARSGCPSVTDYFDKESLDGYCTSHKGFSGT
VFSSGSSYGYKSNSSRGSSSGHTSTAGESSTTGSGEESGGDNSVNSEDTNNSSTDTGTAG
TAGTGEASGAETPAAEAPAAETPAVETPAADAPAATQ

Enzyme Prediction     

No EC number prediction in MGYG000004634_00972.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	148	332	3.8e-61	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	4.89e-172	159	786	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.55e-162	91	796	5	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.69e-140	96	822	4	758	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.39e-71	147	333	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
PRK11636	mrcA	2.35e-68	157	822	62	822	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCU02608.1	1.46e-195	95	834	33	783
AMJ40953.1	1.39e-194	96	838	43	789
CBL24654.1	9.96e-191	95	834	33	784
QUH28358.1	1.44e-188	90	814	27	738
ASM68625.1	1.74e-186	116	835	50	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	6.21e-89	140	824	20	803	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	5.81e-59	255	758	5	436	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
4OON_A	1.17e-54	143	823	23	760	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.31e-54	143	798	10	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3ZG7_B	4.19e-54	255	758	5	436	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	1.41e-105	89	810	9	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.41e-105	89	810	9	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	1.83e-105	89	810	9	670	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0SRL7	1.18e-100	115	815	45	697	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q0TNZ8	2.83e-100	116	815	46	697	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
92	123