CAZyme Information: MGYG000004636_00448

Basic Information

• Species: Paramuribaculum sp009775605
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp009775605
• CAZyme ID: MGYG000004636_00448
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	MGYG000004636_10|CGC1	38202.45	4.8081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004636	2253564	MAG	Germany	Europe

• Gene Location: Start: 4132; End: 5157 Strand: -

Full Sequence      

MESIEQNPVYYDLAFEMPLHADSVDISRWLTDYARRRYGAESHSAAEAWQLLLQSAYRPG
TNGTENSSIVAARPALNVKKSGPNAGFDIPYDPDCLVRAEKLLLADADRLGASAPYSFDV
IDVQRQIMSNLGQSIHRAAAKAFREGDAEAFGLHSSRFLELLSDMDALLRTRPEFNFDRF
LGNVRSWGTSADEKDLYERAASELYTVWGADGDPLIFDYSWKEWSGLIKGYYLPRWERFY
AMLADSLRNGTGYSEEGLALTHGREAFRANDFYSNLGDWELRYVATPGKARVPAVEGDPI
VTARRLHDKYTALGAEYSASDSASDAAPVAKKRYENLGEKE

Enzyme Prediction     

No EC number prediction in MGYG000004636_00448.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	1	307	3e-71	0.4374057315233786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12972	NAGLU_C	2.37e-81	29	304	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48266.1	1.11e-155	1	339	415	752
QQT79630.1	1.58e-155	1	339	416	752
QUU09704.1	1.58e-155	1	339	416	752
ASM67128.1	1.58e-155	1	339	416	752
QRP58487.1	1.58e-155	1	339	416	752

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	3.13e-39	2	250	576	831	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	3.15e-39	2	250	584	839	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	7.97e-39	2	250	599	854	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.42e-32	2	310	423	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	2.78e-36	1	249	475	757	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	8.13e-32	2	310	446	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004636_00448.