CAZyme Information: MGYG000004636_00908

Basic Information

• Species: Paramuribaculum sp009775605
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp009775605
• CAZyme ID: MGYG000004636_00908
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		36287.4	9.0762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004636	2253564	MAG	Germany	Europe

• Gene Location: Start: 31893; End: 32840 Strand: +

Full Sequence      

MKRYINYLLILSFPFMSCTAYAQQQRLESAPVVNPEIPSKVEFAGKAVKLDRPDLWERYD
RELTSMVYTHGNTLLTIKRANRYFPVIMPILKANGVPTDLAYLACIESYLNPRAYSPAKA
AGFWQFIPSAGKDYGLEINDYVDERYNLEKATAAAARYLKSSYNRFGNWESAAASYNTGV
ARVSRELEAQQASSAYDLYLAEETSRYMFRLLAMKEIMEHPAKYGFNLTADQLYQPLEYK
TVTVDYPVEDWPTWAQEQGINYLILRDNNPWIRAKSLPNKTGKAYKVLIPTKASLQRITD
PSKLKVFDHNWINER

Enzyme Prediction     

No EC number prediction in MGYG000004636_00908.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	89	218	2.1e-23	0.8592592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.58e-58	91	216	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	3.42e-27	19	228	54	254	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.69e-23	86	185	1	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.17e-11	107	185	11	87	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PHA00368	PHA00368	1.36e-10	93	212	21	139	internal virion protein D

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD43280.1	9.74e-142	32	314	48	328
QCD35372.1	1.27e-138	8	312	24	331
QCP73626.1	6.35e-138	20	312	36	326
QCD39978.1	6.35e-138	20	312	36	326
ASB38769.1	1.95e-137	32	312	41	319

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	1.33e-23	43	292	62	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	1.33e-23	43	292	62	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	7.78e-13	67	187	9	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000653	0.417749	0.580918	0.000258	0.000214	0.000185

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004636_00908.