CAZyme Information: MGYG000004640_00520

Basic Information

• Species: Prevotella sp900551055
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900551055
• CAZyme ID: MGYG000004640_00520
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000004640_15|CGC1	45095.74	5.2411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004640	2596429	MAG	Germany	Europe

• Gene Location: Start: 19339; End: 20520 Strand: -

Full Sequence      

MLNCLLFRRSGLRRISGNGIRNFILACILAVPSAAVAQHALCNPSPMPEAQNVYDLLWSV
YREKAVSATVANVDWNIREAENVHEWTGKWPVMNVFDFINFHNSKDVDPKGWLDYSDISV
AENWWNEGGLVGCMWHWNVLANDGKTLTCTPGTEPGQTSFDVSKVDDTASDEYKQIVSDI
DQIAKYLGKMQEAGIPVIWRPLHEAAGNIYEYEGGQAWFWWGAKGAEPFKKLWRLMYDRL
VNHHKLNNLIWVWTSQTSPYDGVADSAWYPGDEYVDVVARDSYYALQYPLMKEYNALSTM
FPGKLVALAECGNGDEVNMSPWSKIWQQGSRWCWFMTWYDYNYNAGQSQEHKFAGKDWWT
DAFNSGTVLDRDAFRQLRGSSHKYVLVKDNQVL

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	43	372	1.3e-81	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.49e-52	43	341	2	285	Glycosyl hydrolase family 26.
COG4124	ManB2	1.83e-16	170	283	157	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRX62597.1	7.84e-110	48	378	125	449
ARK08557.1	6.63e-96	41	378	142	456
QIK58757.1	1.87e-95	41	378	142	456
QIK53340.1	1.48e-94	41	378	142	456
AET14832.1	7.14e-93	48	378	116	435

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HF2_A	2.82e-82	41	371	45	353	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	3.04e-73	41	376	4	336	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]
6D2W_A	5.09e-69	41	376	95	427	Crystalstructure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14],6D2W_B Crystal structure of Prevotella bryantii endo-beta-mannanase/endo-beta-glucanase PbGH26A-GH5A [Prevotella bryantii B14]
3WDQ_A	1.49e-47	43	372	36	350	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	1.87e-46	23	390	123	463	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49425	2.85e-53	41	340	146	431	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
G2Q4H7	7.92e-49	23	340	152	447	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.49e-39	43	338	30	319	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P55298	1.51e-36	41	384	156	469	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	7.51e-36	41	384	158	471	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.050756	0.925093	0.022242	0.001157	0.000394	0.000347

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004640_00520.