CAZyme Information: MGYG000004643_00979

Basic Information

• Species: Eubacterium_R sp003526845
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Eubacterium_R; Eubacterium_R sp003526845
• CAZyme ID: MGYG000004643_00979
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	MGYG000004643_3|CGC1	90024.16	4.9818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004643	1975847	MAG	Germany	Europe

• Gene Location: Start: 35369; End: 37726 Strand: +

Full Sequence      

MKKICLNGKYDMIDTADGSVICKADIPGSDFGNMIKNGLIENPLNMTKPEELVKSVYSKN
IAFETKFSLDGDDIAKKHIRIFVDKIDTLCSCFVNSKPAFKSNNEHISIEKDIKALVKKG
ENTIRFEIADPVKYIEDMQKKHALPPNSNGINGAPYLRKSACHFGWDWGPCVPYKYLGNV
EIQCFDKKIENIAVNQKIEGDTAFVSVFADGADKIALFAPNGDEIKGNDGEFEIQNPELW
YTRDLNEKNEQPLYTVELSNGEETVTKKIGLRTVELNREKDEYGENFQLVVNGKRIFAKG
ANLIPFAAIPDLADEKTVDYYIDLAVKSNFNIIRVWGGATYANEYLMTKCDEKGILIWQD
FCYACLLYPFYDDEFLQNVLYEAEQNVKRQQLHPSLGLYCGNNEIEAMFSYLPRNSKIIK
AYIEFFYHQLPEHIKDYLTVPYIPSSPLGDKPFSQNTADGVGDTHMWNVWHGLKPLNYYE
KRYTRFLSEFGLESLPSMKAIKTFATESEFDLASDAFMSHQKCEGGNEKMMFYLKERFDA
PIHFEDLPYLTGIVQADCIESATLHFRRNKGRCNGSVFWQFNDVWNCPSWSGVDFEGVPK
ALMYKAKEFFAPVTVAYSNNDFYAINDTLNDKTVDFKITDTEGDIYEFKFNLKSDSINKI
YSKQIKENTAVKVCWEGDERIFDNFKTLEKANIAVCAEGNKVRLKSDVFARNVFIDCDAN
ADKNYFSMMPGEEVIVTFDKDVDSLSVKCENNIEFEKSGIKKKFSQFFYRLKPLNIANTF
YYEYN

Enzyme Prediction     

No EC number prediction in MGYG000004643_00979.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	56	752	1.5e-63	0.7327127659574468

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.57e-64	1	618	10	637	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	3.90e-07	697	743	12	61	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.71e-04	178	272	18	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98156.1	1.17e-142	1	738	1	801
AUG59052.1	2.70e-137	6	761	5	810
ADZ84812.1	2.40e-130	1	756	1	807
QEH70285.1	3.37e-130	1	756	1	807
QNF27003.1	2.63e-128	1	629	1	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	5.30e-95	24	736	35	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	5.41e-95	24	736	35	830	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	3.68e-94	24	736	33	828	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	3.76e-94	24	736	35	830	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.42e-86	24	737	28	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	1.74e-67	4	631	23	713	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	4.48e-67	4	625	23	704	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q2TXB7	1.72e-65	56	615	61	658	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	1.13e-64	56	615	61	658	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q5B7W2	1.00e-63	75	615	79	658	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004643_00979.