CAZyme Information: MGYG000004644_00651

Basic Information

• Species: Negativibacillus sp900547455
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Negativibacillus; Negativibacillus sp900547455
• CAZyme ID: MGYG000004644_00651
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225	MGYG000004644_26|CGC1	25541.83	9.4155

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004644	2240162	MAG	Germany	Europe

• Gene Location: Start: 16045; End: 16722 Strand: -

Full Sequence      

MKVSLIVPVLNEIKKVDSFLAMLQKMPGDWEILFADGGSTDGTLEHLKGKARVIACPKGR
ARQMNAAAREATGQVLWFVHCDSLLPQDAYRKIAAAVEGGAQFGCFTIGFDYDGPFMGCN
TFFSNRRAKKGQIAFGDQGIFMTRELFLQQNGFPDLPLMEDYELSLRMKRQHIPLVVLDS
TIITSGRRYQRQFPLLTMGKMFWLRCLYRLGVDPQKIADMYRDIR

Enzyme Prediction     

No EC number prediction in MGYG000004644_00651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	123	5e-17	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04283	glyco_like_mftF	7.23e-93	3	221	1	220	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
cd02522	GT_2_like_a	3.37e-76	3	221	1	221	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	4.92e-17	4	98	1	104	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.12e-16	4	177	1	190	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	1.03e-15	2	170	1	192	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM01606.1	8.21e-67	3	225	2	223
BAE84490.1	3.31e-66	3	225	2	223
ACL21876.1	3.31e-66	3	225	2	223
CDX02802.1	3.31e-66	3	225	2	223
QCX33265.1	2.89e-56	3	225	2	224

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004644_00651.