CAZyme Information: MGYG000004645_01732

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1322
• CAZyme ID: MGYG000004645_01732
• CAZy Family: CE15
• CAZyme Description: Carbohydrate esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39864.14	5.6949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004645	2112164	MAG	China	Asia

• Gene Location: Start: 4754; End: 5818 Strand: -

Full Sequence      

MKLPALLKLNDGRWVENAADWQLRRREILDVLRREEYGYSPEAPGCVKGTVRAVDKKCCS
GHARLETIVLSFAAEKGEFSFPVKFFVPENGKKNPLLLLLNFRPDAYDMYFPAEEIIDNG
FALAVVYYQDITSDNGDFTDKLAGLYSRRHDGTDWGKISMWAWGASRALDYLLTRCEVDA
ENTAVIGHSRLGKTALWCAAQDERFRFAFSNDSGCAGAALERSKHEGAETVEIITRVLPY
WFCENYYRYANNVEAMPFDQHFLLGAIAPRFVGVGSASLDAWADPYSEQLCCCEASPAWQ
CQGQSGFIGSGEPAKAGDSFQEGDIAYHLRDGIHFLGRADWLQYMAFMKRKIKK

Enzyme Prediction     

No EC number prediction in MGYG000004645_01732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	2	353	5e-74	0.9925650557620818

CDD Domains     

MGYG000004645_01732 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE95892.1	1.74e-104	1	350	9	359
ALL53565.1	8.24e-88	2	350	12	357
QOV20253.1	4.83e-81	3	349	13	356
QDU37053.1	8.00e-74	3	354	42	433
QNK58798.1	1.10e-70	3	347	8	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GRW_A	7.86e-63	3	353	7	398	GlucuronoylEsterase from Opitutus terrae (Au derivative) [Opitutus terrae PB90-1],6GS0_A Native Glucuronoyl Esterase from Opitutus terrae [Opitutus terrae PB90-1]
6SYU_A	1.24e-62	3	353	25	416	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with xylobiose [Opitutus terrae],6T0I_A The wild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with the aldotetrauronic acid XUX [Opitutus terrae]
6SYR_A	1.84e-62	3	353	36	427	Thewild type glucuronoyl esterase OtCE15A from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1]
6SYV_A	3.44e-62	3	353	25	416	Theglucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-glucuronate [Opitutus terrae PB90-1],6SZO_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with D-galacturonate [Opitutus terrae PB90-1],6T0E_A The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1],6T0E_B The glucuronoyl esterase OtCE15A S267A variant from Opitutus terrae in complex with benzyl D-glucuronoate and D-glucuronate [Opitutus terrae PB90-1]
6GRY_A	7.36e-62	3	349	14	393	GlucuronoylEsterase from Solibacter usitatus. [Candidatus Solibacter usitatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0K2VM55	1.64e-46	3	347	42	422	Carbohydrate esterase MZ0003 OS=Unknown prokaryotic organism OX=2725 GN=MZ0003 PE=1 SV=1
K5XDZ6	1.61e-22	2	303	43	336	4-O-methyl-glucuronoyl methylesterase OS=Phanerochaete carnosa (strain HHB-10118-sp) OX=650164 GN=PHACADRAFT_247750 PE=1 SV=1
B2ABS0	7.07e-22	4	303	118	412	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1
P0CU53	1.06e-21	2	303	44	338	4-O-methyl-glucuronoyl methylesterase 1 OS=Wolfiporia cocos (strain MD-104) OX=742152 GN=WOLCODRAFT_23632 PE=1 SV=1
P0CT88	2.31e-20	2	308	43	344	4-O-methyl-glucuronoyl methylesterase 2 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.11.1537.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004645_01732.