CAZyme Information: MGYG000004647_00188

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000004647_00188
• CAZy Family: GH103
• CAZyme Description: Membrane-bound lytic murein transglycosylase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	MGYG000004647_1|CGC2	39818.51	6.9829

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004647	2277649	MAG	China	Asia

• Gene Location: Start: 205955; End: 207031 Strand: -

Full Sequence      

MPKLTRRQLGTFAMLYGLGVMTPLWAKAPAAGVNYTDREDIIAFLKEVSAEKGIPYDWLE
TEIALARYSPLAERYMTPKPQTGPATTPDRNFRLYQRNMVNSERISKGVDFLEQHIELFS
HIENTQGVSRYAIAAIIGVETIYGKNMGRFRVLDVLVTLAFDYTRRATFYKKELAEFLDF
CWRDKLPTVSVTGSYAGAIGYGQFMPSSLNSFGTDGDNDGFIDIINNEADAIASVAAYLK
AHGWKAGLKPLYPVKQKIRPETIPPSTGIRADKTVDGLLKGGIEPVGLLDLPLNHPVLLV
DLPWQDDGGPLERHLYIGTQNFSAFLYYNRSYFYAAAVSMLAQALEDASKSTKEKSGS

Enzyme Prediction     

No EC number prediction in MGYG000004647_00188.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	42	345	2.5e-75	0.9796610169491525

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13406	SLT_2	3.10e-84	45	343	9	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
TIGR02282	MltB	2.83e-78	43	345	2	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG2951	MltB	5.47e-70	1	345	1	335	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
PRK10760	PRK10760	3.26e-52	34	348	53	356	murein hydrolase B; Provisional
cd13399	Slt35-like	6.99e-18	127	258	2	88	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF23912.1	4.26e-125	27	346	44	362
QDA55336.1	6.82e-119	28	346	88	405
QQS90106.1	9.25e-119	27	347	137	457
ANU65602.1	1.30e-61	11	345	13	348
QQQ96748.1	1.30e-61	11	345	13	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O8X_A	6.92e-43	90	342	51	296	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	1.05e-42	90	342	68	313	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	2.57e-34	32	345	10	314	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	2.68e-34	32	345	12	316	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5ANZ_A	1.03e-23	95	346	99	344	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	3.17e-33	32	345	51	355	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.001134	0.000343	0.950262	0.047940	0.000012

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004647_00188.