CAZyme Information: MGYG000004647_01754

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella
• CAZyme ID: MGYG000004647_01754
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000004647_14|CGC1	44702.8	5.3646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004647	2277649	MAG	China	Asia

• Gene Location: Start: 28635; End: 29840 Strand: +

Full Sequence      

MNKTLRLLSLSVLGALTSWNVMAADAPANTEAKAEAQALVSESLPALHPVRSLKNAPTDT
WPAWKEFRESALDAGRVIDRSDERLITTSEGQSYGMFFALVANDRPSFDAMWQWTVANLC
EGDCGKTRMAWLWGANESVKNAKAPLKWGVIDSNNATDADLWIAYTLLEAADRWEEPKYR
DDAMKLLERVKADVRVVRGLGAVLLPANVGFEKNGDVVLNPSYYPISVLKRLEAVDPLWR
EVRWGSMRALVRSAESGLSPDWVAFGERWGSRNRDESSEGSWNAIRVYLWAGMMPQDDPD
AVRLREILSPMVDVAKRRFYTPVSTDTAAFTVSKSGPFAFGACVLPWVKDDKVGAYIRTG
LSKMAFTGEDYYRSVLVLFGLGFDQGRFAFDHQGRLVIQGD

Enzyme Prediction     

No EC number prediction in MGYG000004647_01754.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	61	383	6.6e-73	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	8.61e-117	52	397	16	365	cellulase.
COG3405	BcsZ	8.85e-71	59	390	24	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	3.18e-54	58	386	1	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53782.1	7.85e-109	43	397	51	408
QDA53874.1	4.70e-104	52	399	15	361
QQS88762.1	8.88e-102	61	398	28	361
ANU67169.1	7.10e-95	57	401	18	353
QQQ96024.1	7.10e-95	57	401	18	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	4.37e-83	60	397	3	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	1.93e-80	60	396	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	5.44e-80	60	396	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
4Q2B_A	1.02e-79	58	397	1	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
3QXF_A	3.84e-78	60	397	3	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	7.94e-84	60	397	24	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	1.26e-82	60	397	24	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8ZLB7	1.81e-79	60	397	25	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	4.03e-78	60	397	25	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	2.44e-63	61	397	33	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.998986	0.000201	0.000181	0.000161	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004647_01754.