CAZyme Information: MGYG000004650_01590

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004650_01590
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1248	MGYG000004650_84|CGC1	137453.16	4.8754

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004650	2976949	MAG	China	Asia

• Gene Location: Start: 2327; End: 6073 Strand: -

Full Sequence      

MGKIRHYYVGACLLVSSAAFAQVPSHSMYVNESSKSVPFYEAYSNWQPGTPLFSDAAAED
EEFFISRVKPKERFTNSATQVDPEMTPDRKLIWWCPIGTADGGGWKSLPSYFFDSEVFSM
WSYVDIYGNWTAPMIRMAGAFTDICHKNGVRTSTLASVPWASTVTATDGGHGQTMKAMID
GGADKLLKFLRYYGIDGIGYNSEFSIGSGLSADGLKTLLSQCFAKREAAKWPYFTNAWYS
LMTSGGTVGGGDALSSSNQDWFHWNGNPTSDAYFMNYNWGASGLSTSQSTAKSFAGRSSY
DVYGGMDFQGRSVADWIALKNAEISVGIWGAHNMNMIFEGRGELGSSPLTKQKTYQLISE
NVFTGSTYNPVNDLKIQNILRHSTTATDFHGFSKFITARSVLASDDLAAEPFVTYFNLGN
GTFFNVKGETTFKNEWYNIGMQDYLPTWRWWFTANFMGRDVTDVPSKGLKAEFTWDDAWF
GGSCLSIAGQTDREYLHLFKTQYSLKSGDVLTIRYKVVSGTGSVAVACSAEGKEGTEVSA
TVGNNITSSKEWVAKTIKVGTLPGTLRLNKETLAMLGLRFEKTSADFKVLIGEISLTRSD
ALTPNQPIITNQKLLAANYKGLDFKVFFKMKDRDAAHPEDPIYNEDVNTWYYKIYIQQEG
GEPVMCTATTSWAAYVVSAPFDVNGDKKVKLGVSAVALDGKSESEIAWTGWLDTPDNSTV
EGIEIDKPVIKSGETFAIKYIDPTHAPADKWEILNAQTGVVVKDFPSSVSLETALSEIGI
YDLRITSGENIELHQALIQISSEEVGAMPEIKTLTANDSDSPISIEKGDKVTYKYIGRNA
DGYVSRGLRLNEIAFGVPADQLNFNSQSPFTIAFWFKPAVFNHISDGTHLLNIRAAEDRW
PDSDWGWLWTHIQASDNKLSFNLKKKESGAGSETKIIAEDFTFVPNQWYHLAVVVDYQNG
RNVSLYVNGKLINSGGGITNVKDWKNSYTIMVGGIAANRAGFDGYLDEFQLYNKGLTAEE
VKKSMEHQTVIPESLIGYWDFETEPNENNEILSTGSNKTLKGYMTEIKTVSQGVNQYVPV
DITYGTGAPFISGSIFKVETKPSWKLEEAQIQGDITGTGEAGSVVAAYPSEGEFNAILTL
ENGWGSVSKTYRSVTVTDGGVGFADNELEIAYNAYPNPFVDELNIRFANEGTYAIEVFDA
AGKMIDAKETTVADGENIHLSVNGAAGIYFINIKQDTKILKALKVIKK

Enzyme Prediction     

No EC number prediction in MGYG000004650_01590.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	113	424	2.3e-44	0.9428571428571428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06547	GH85_ENGase	9.16e-37	113	451	22	334	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
COG4724	COG4724	2.55e-35	9	597	14	550	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
pfam03644	Glyco_hydro_85	8.49e-24	113	421	5	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
pfam13385	Laminin_G_3	3.04e-19	856	1022	6	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
TIGR04183	Por_Secre_tail	5.41e-10	1174	1248	1	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74379.1	0.0	9	1248	10	1241
QUT74450.1	2.87e-273	14	1248	13	1253
AHF11930.1	5.34e-267	41	1248	38	1253
QFQ13703.1	1.38e-265	10	1248	10	1247
EFC71164.1	1.76e-245	59	1248	55	1247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FHA_A	6.74e-26	113	516	76	451	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	6.74e-26	113	516	76	451	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
2VTF_A	1.22e-25	113	520	81	460	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000446	0.998695	0.000271	0.000185	0.000176	0.000157

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004650_01590.