CAZyme Information: MGYG000004650_02109

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter
• CAZyme ID: MGYG000004650_02109
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		43288.97	9.3693

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004650	2976949	MAG	China	Asia

• Gene Location: Start: 1394; End: 2497 Strand: +

Full Sequence      

MYKKVLILLFFIPFQLLFAQKSMLKDFPEGSTPEEIGKRLAYRFLTEKHALHVGKWIGYP
ETFYWNGALRYAYLAKDKELLNRLQDKFEPLFTEEKALQPIMNHVDVNMFGSLPLELYLV
TKDKKYWYLGLPYADSQWKVPANAKPEEKEWAEKGYSWQTRLWIDDMYMITIVQTRAYKV
TKDKKYIDRAAKEMVMYLDELQRPNGLFYHAPDVPYYWGRGNGWMAAGMTELLQCLPKNH
KDRPRILQGYRTMMESLKKYQNPEGLWNQLIDQSDCWTETSGSAMFTFAFIKGVKNGWLN
AEEYAPAARKAWIALVSYLNDKNQVREICVGTNKKNSKQYYYDRPRRTGDYHGQGPYLWC
AAALMEK

Enzyme Prediction     

No EC number prediction in MGYG000004650_02109.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	58	364	3.7e-72	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.59e-52	58	362	28	337	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.91e-43	38	358	21	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26138.1	8.07e-286	1	367	1	367
QDH53377.1	6.63e-285	1	367	1	367
QQR15953.1	1.48e-272	1	367	1	367
ANU59126.1	1.48e-272	1	367	1	367
QGT72398.1	1.61e-251	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.53e-35	162	366	199	412	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	5.47e-29	103	358	85	358	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.35e-28	103	358	75	348	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.64e-24	163	312	158	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.20e-24	163	312	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.00e-28	103	358	85	358	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	2.30e-17	163	325	201	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	8.14e-17	117	325	111	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	3.67e-16	133	325	139	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P0A3U6	3.53e-09	215	365	61	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000282	0.999091	0.000191	0.000144	0.000143	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004650_02109.