CAZyme Information: MGYG000004655_01100

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004655_01100
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000004655_17|CGC1	31773.33	7.7108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004655	2984748	MAG	China	Asia

• Gene Location: Start: 1042; End: 1860 Strand: +

Full Sequence      

MNVSIVTYHTDIDELSLCLRSLDSPCVDTIYIVDNAADGVMRDFCAGIPSVEYLSSSNDG
YGAGHNQAMLRSLEAGVDYHLVLNSDVEFEPCILEKAVSLMDSHDDIALVHPRLEYPDGR
QQYTARLLPTPLDVFARRFLPGFLFRGRDRRYTLQFADRSEALNVPYVQGSFMLIRCQAL
RETGLFDTRFFMYPEDIDLTRRLHRRYKTLYWPGISAVHKHKAASYRNFRMLWIHIVNMA
RYFNKWGWFADCERRRMNRILLKYLSDRGYNP

Enzyme Prediction     

No EC number prediction in MGYG000004655_01100.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	3.91e-35	1	272	5	272	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	4.41e-31	3	221	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	4.57e-16	5	238	3	220	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam13641	Glyco_tranf_2_3	1.15e-10	3	230	6	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04185	GT_2_like_b	2.54e-10	5	222	3	175	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD37025.1	1.03e-112	3	261	5	263
ABR40593.1	2.01e-104	1	266	2	267
QUT58341.1	2.01e-104	1	266	2	267
QQY37268.1	2.01e-104	1	266	2	267
ANU57691.1	9.05e-93	1	266	2	267

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	3.90e-12	14	225	19	240	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	3.90e-12	14	225	19	240	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004655_01100.