CAZyme Information: MGYG000004655_01182

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004655_01182
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429	MGYG000004655_18|CGC2	47856.1	9.2477

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004655	2984748	MAG	China	Asia

• Gene Location: Start: 39583; End: 40872 Strand: -

Full Sequence      

MNPLYTAGIAVYGGAARLVSLGSPKVRHMLSGQKETIGRLRAFREHMAPDGFDVWFHAAS
LGEFEQARPIIDSLLTHDPAKRILLSFFSPSGYEVRCDYNPRVAVVYLPFDIPGNVDAFL
DAARPRMAIFVKYEFWGNYLEKLKKRGIPTYIISAIFRPSQRFFKPWGTMFRKMLENFEH
LYVQDERSLRLLAGIGIDRVTVAGDTRFDRVTAIRENRKAIPEIECFLSAGGKKSFTMVF
GSSWEADEKVYVPWLKEHADVRAIIAPHEFDKNRLAEMRRRLGSGSTMLFSDFKTLYQSS
PEEAAKAAGKLKYLIIDCFGLLSSLYAYADVAYVGGGFGVSIHNINEAATYGIPVVFGPK
HSKFKEASDLIGCGGAFCIDSTGAFRATMESLLDEASRKRAGKAAGHYIESNIGASDIIM
ADLFPRIKS

Enzyme Prediction     

No EC number prediction in MGYG000004655_01182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	44	210	9.1e-47	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1519	KdtA	1.64e-59	20	427	24	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	1.96e-56	49	210	11	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
PRK05749	PRK05749	5.68e-54	46	425	45	419	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR08145.1	9.67e-144	1	429	1	414
ASB37412.1	9.67e-144	1	429	1	414
ANU64487.1	9.67e-144	1	429	1	414
QCD36286.1	1.12e-143	1	426	1	410
BCI64150.1	4.59e-136	1	424	1	407

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45374	3.47e-25	14	416	12	416	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1
Q1RGU8	1.07e-24	34	394	28	381	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
P0AC76	1.57e-24	43	427	42	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P0AC77	1.57e-24	43	427	42	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC75	1.57e-24	43	427	42	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004655_01182.