CAZyme Information: MGYG000004655_01888

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004655_01888
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362	MGYG000004655_44|CGC2	40605.41	4.6328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004655	2984748	MAG	China	Asia

• Gene Location: Start: 18306; End: 19394 Strand: +

Full Sequence      

MNRLAIGLLAVSAAFAACTQQKTAGNEPSAITPAEELRGRLEAQTAEGKILFGHHDDPVY
GHDWKFERGRSDIKDITGKYPAMMSWDLGRIELGDSLNIDGVPFSRIREEVRAQNARGGV
NTFSWHLWNPVNGGDSWQVTDSTIVTKMANDSVYNKLYREQVRAVAAFLGSLTDENDRRI
GVIFRPWHENSGGWFFWGSPLCSAEDYQKLWTDMREEMDAAGIDNVLYAYSPDRTDTLED
YMKRYPGDELVDILGMDIYHFGGEDGTDEYRTAVSTGLGIVRQAAQEHGKIAAFTETGME
SIPMAGWWTDVLLPLLKENPVSYVVVWRNAHDKPGHFYAPYPGQISEESFKTFATDSTII
LI

Enzyme Prediction     

No EC number prediction in MGYG000004655_01888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	28	329	2.6e-55	0.8976897689768977

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.89e-31	50	291	24	263	Glycosyl hydrolase family 26.
COG4124	ManB2	5.85e-13	136	300	143	298	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38980.1	1.84e-116	9	353	8	355
QCP72670.1	1.84e-116	9	353	8	355
QRX64949.1	2.75e-115	8	353	7	356
QJR77817.1	2.65e-111	3	362	6	359
QJR68951.1	2.65e-111	3	362	6	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	4.22e-108	50	362	27	336	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	3.52e-72	50	360	57	386	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	3.52e-72	50	360	57	386	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	6.58e-72	50	360	80	409	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	2.76e-71	50	360	57	386	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	7.40e-35	50	356	73	402	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.17e-31	14	354	26	387	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49425	2.12e-15	50	309	170	424	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
O05512	2.57e-15	47	259	55	268	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
G2Q4H7	1.06e-14	28	289	161	424	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004655_01888.