CAZyme Information: MGYG000004658_02768

Basic Information

• Species: Alistipes finegoldii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes finegoldii
• CAZyme ID: MGYG000004658_02768
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000004658_122|CGC1	74094.92	5.1092

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004658	3509081	Isolate	United States	North America

• Gene Location: Start: 27863; End: 29860 Strand: +

Full Sequence      

MKSFLFSLAALALCGACSQNTEVTSPDGTIRLAFAVDSAGRMTYSVTDGGVRLFEPSRLG
FEAAETDLGGGFAVEHVSRTSVDETWTQPWGENKENRSRYNEMAVRLRNGGGVRLTLRFR
VFDDGLGFRYEYEACGADSLRVTDELTEFRFAADGDSWTIPASFDTYELLYRKLPLSELA
DANTPATFKVGGLYGSIHEAALYDFPEMTLRKTDGLAFKSDLAPLPDGTKAHVGNKFTTA
WRTVQLAPDAVGLINSSLILNLNEPSKIGDTSWIRPMKYVGVWWGMHLGVETWAMDDRHG
ATTENAKRHIDFAAANNIQGVLFEGWNEGWENWGGSQSFDFTKPYADFDIAEIVRYARER
GIEIIGHHETGGNIPDYERQLERAVKWYADLGIHNLKTGYAGGISGGNNHHGQYMVRHYQ
HVVETAAKYRMTVNAHEPIKDCGIRRTWPNMMSREGARGKEWDAWSAGNPPSHEVTLPFT
RLLAGPMDFTPGTFDILYENTRNSPRRKLWNCGPEVDMRVNTTLAKQIAEWVIIYSPVQM
ASDLIENYEGHPAFRFFRDFDADCDWSRALAGEPGEFVAVVRRAGENYFLGAATDEQPRT
LSLPLDFLKPGTKYRATIYADGPDADWKTNPTSYTISEREVSSADTLEVAMAPGGGQAVS
FMPAI

Enzyme Prediction     

No EC number prediction in MGYG000004658_02768.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	661	2.1e-230	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.15e-142	270	560	1	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	7.97e-88	25	265	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	6.82e-45	564	662	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd06563	GH20_chitobiase-like	1.41e-04	283	367	3	111	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	0.001	283	367	3	103	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFL78734.1	0.0	1	665	1	665
ALA72635.1	0.0	1	663	1	668
QUT86013.1	0.0	1	663	1	668
QJR78376.1	0.0	1	663	1	668
QJR69891.1	0.0	1	663	1	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	2.00e-183	23	661	3	658	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	2.00e-183	23	661	3	658	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	5.65e-183	23	661	3	658	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	8.16e-163	22	660	4	702	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	8.41e-163	22	660	13	711	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	8.09e-163	2	660	4	722	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	9.24e-62	8	659	4	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	7.58e-48	38	656	55	615	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000031	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004658_02768.