CAZyme Information: MGYG000004659_00405

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Mailhella
• CAZyme ID: MGYG000004659_00405
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		43381.51	8.058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004659	2355365	MAG	China	Asia

• Gene Location: Start: 9641; End: 10792 Strand: -

Full Sequence      

MKTLWINAGEISGDLQGGALLSALRDITPEGDLRVVGMGGDNLARAGQENLLRVEELSVM
GIVEVITSLPRIFGLLRRIRREMERIRPDAVLLIDAPEFNFRVAKIASGLGIPVYYFIPP
KVWAWRTGRVKFLKRHVRRIFSILPFEVDFYRSHGMEVTYVGNPLVDLVDYESIRDVEPV
PHRIGLMPGSRRKEVESLMPAFAGAANMLVKKFPDLEFHCVRSSNFSEEYLRKLWNCEVP
LVMHDGKDRYRLMRTFQCILAASGTATLETGLAGVPTLVAYKVSPLSYQVALRVIKVKWI
SLTNLIMNRTVFPEHIEKEADPAPMARRVEDWLDHPQKLEAVIRDLEELRERCGERGSAL
RAAEALAGELLPTLAEREDAHRC

Enzyme Prediction     

No EC number prediction in MGYG000004659_00405.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	352	1e-107	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.94e-109	1	371	1	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	5.27e-108	1	366	1	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.36e-86	6	326	3	332	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.40e-77	3	365	7	381	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.53e-51	1	367	1	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS95839.1	4.24e-148	3	370	4	369
ADP86417.1	4.24e-148	3	370	4	369
ABM28724.1	1.21e-147	3	370	4	369
ABB38982.1	3.07e-138	2	363	6	365
CAJ55109.1	1.13e-134	1	371	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.75e-49	3	367	8	381	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.48e-48	3	367	8	381	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	1.65e-72	2	363	7	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q6ALW0	1.41e-71	4	364	12	380	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q2LVL8	1.83e-71	2	363	4	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1INL4	9.90e-71	1	379	1	382	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q1D393	1.59e-69	8	372	11	379	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004659_00405.