CAZyme Information: MGYG000004660_00196

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000004660_00196
• CAZy Family: GT2
• CAZyme Description: Trans-aconitate 2-methyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1107	MGYG000004660_5|CGC2	128886.64	5.0126

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004660	1964208	MAG	China	Asia

• Gene Location: Start: 23085; End: 26408 Strand: -

Full Sequence      

MELNSKDYWDHRFDTDWEEYGGSKQTRFFAKVALKMMPEWLIREIRLNQYKICDMGCALG
DAVDELSKQLEDENICGLDFSEEAIKIAQKRYPEYSFYVGDLNKGIEDTSVDVVFCSNVL
EHMEKPKKILENFSGIAKKYIIILIPFKEEYKIEEHITKFYENNIPVNIGDFHLIYTDSV
DASKIPDSYYPDQQILLVYSCDKNNISLTKLEDTVKGSNKSFLKKYVSKEENEILKTEKA
AAERLLQERTEQFDSVKTCLEEVNEGLKLELDDIKISRDTILQKNEELSGQLNTITGCYQ
EEQKNREEIQAEHERLLEIKNSLEEQVNALKEENISLKDSLDNALFVAEQKDLIIQRALQ
QCDKMLGAKLFKVTHLMNRTLNQGIRGSKEERKLFRKWVFTHHKTGGDRDRRYNPLWPLI
DILKSPIPESIGCLNKSSEDRGVIENNKSQEVIIENVVKDNVYIDKDRMDILSKEYTAYD
VIILSVIDYDFRYQRPQHFADRYAANGHRVFYINANHYNPDSVTQLKENLYIVNIFNPQY
NAIHLTDWGEQQKELQQHLRNLMDTYCIRDAVTIVDYPNWFLAAKYLKEMYGFKVITDYM
DDYTGFLNPAEKLVGENCKKLLKYSDEIIPSSQFLYDIAKEYNPDISIVRNGTEFAHFHQ
AYGKNTKKQRAIIGYYGAIAEWFDVEKVCYLAKKMPQCDIVLIGNITAGEKKLRKYENIK
LLGEKPYKELPEYLKDFDVCLIPFDTSTDLIKATNPVKFYEYLSAGKKVVSTEIPELAPF
KDKYVYMANDNDKFMEYVQMCLEGRDTLANEEECIHFAKENDWQQRYEVFASLVEKAVPQ
IDILVLTYNNLKLNKVCINSILQKTAYPNYRLIIVDNLSTDGTREYLKQLDAQHLNNVTI
ILNDSNLGFAGGNNVGMRISDGDYIVLLNNDTVVTRGWLTAMSKHLENNPRMGMCGPVTN
SIGNEAKINVKYNDLKELECFAYDYTTKHLSEEYFKEPRVLALFCTMIKKEIIKKCGLLD
ESYEVGMFEDDDYAEAVKQAGYSLAILEDTFIHHCEGASFKKLQDEKYKAVFEHNKQVFE
EKWNKEWLMHQYREGVTWDSNLNVNIL

Enzyme Prediction     

No EC number prediction in MGYG000004660_00196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	842	980	3.3e-25	0.7764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04950	GT4_TuaH-like	2.36e-58	480	828	6	363	teichuronic acid biosynthesis glycosyltransferase TuaH and similar proteins. Members of this family may function in teichuronic acid biosynthesis/cell wall biogenesis. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd04186	GT_2_like_c	1.10e-41	843	1054	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.81e-38	839	1079	3	244	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	1.58e-22	843	962	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	4.62e-21	842	1013	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN32217.1	5.13e-316	465	1102	837	1473
AOY75534.1	3.79e-214	416	1096	452	1140
ARE85828.1	3.79e-214	416	1096	452	1140
QKV51754.1	9.89e-179	2	1093	6	1009
AYN12149.1	2.57e-178	2	1093	16	1016

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	5.60e-07	836	950	10	121	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32267	1.19e-11	587	801	120	355	Putative teichuronic acid biosynthesis glycosyltransferase TuaH OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaH PE=2 SV=1
D4GYH2	2.37e-07	862	1063	29	216	Glycosyltransferase AglI OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=aglI PE=1 SV=1
P55465	4.15e-07	836	1059	622	850	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004660_00196.