CAZyme Information: MGYG000004660_01218

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000004660_01218
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
134	MGYG000004660_104|CGC1	14169.34	4.8007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004660	1964208	MAG	China	Asia

• Gene Location: Start: 5177; End: 5581 Strand: -

Full Sequence      

MFHGTMNAGVKEFVVDTYKAQVKALKNLQSESGLWHTVLTDPTSYEEVSGSAAIAAGILK
GIKMGILDDSYLECAVKAVAAIMKNIDKDGTVLNVSGGTGMGYDADHYKNILIAPMAYGQ
SLTILALAEALDVL

Enzyme Prediction     

No EC number prediction in MGYG000004660_01218.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	11	130	2.4e-39	0.3704819277108434

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.93e-34	7	131	223	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30792.1	7.96e-74	1	132	240	371
QHB24645.1	9.17e-74	1	132	245	376
QEI32150.1	9.17e-74	1	132	245	376
QIX93991.1	1.46e-71	1	131	240	370
AXB29559.1	1.55e-68	1	132	241	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	2.27e-27	7	131	253	377	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	5.56e-27	4	129	238	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	4.47e-25	10	131	257	378	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4CE7_A	6.32e-09	11	92	250	333	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.09e-17	21	131	231	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
L7P9J4	3.48e-08	11	92	257	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004660_01218.