CAZyme Information: MGYG000004660_01335

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000004660_01335
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465		51420.46	4.4967

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004660	1964208	MAG	China	Asia

• Gene Location: Start: 3073; End: 4470 Strand: -

Full Sequence      

MVIIFPLSVLSSYCEKMPGWVMEKGIYGIFVGNSLQTSSLEASLILDTDIVIEKTENICP
LKENLEEMKAPSEAVQEKRNVWISQSEGKPSIHIKDSDIVTKENVYGIESQKIADPVRKF
VDSLTVEQLILLATGDPAKGQESNLGSAGVSVPGSAAQTSACAQEQELASIVLADGPAGL
RLTKSYQVENGNLVHMPFENNLEGGFLCREKIEAVGETWYQYCTAMPVGTLLAQSWDEEL
LYEVGKAVAEEMQEFCVTLWLAPGMNIHRNPLCGRNFEYYAEDPLLTGKMAAAITKGVQS
EPGCGTTIKHFACNNQEDNRMHSNSILSERTLREIYLKGFEIAVKESQPMSIMTSYNFIN
GIHAANNFDICTKAARDEWNFRGVIMTDWTTTHNDPDCTASGCMRAGNDLVMPGIFQDHD
NIKQALEDGSLKIEGLKLCVAHLVAVVWQSNQYEGIRPYDPFCLF

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	210	413	7.2e-62	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.93e-50	224	413	81	279	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.95e-25	128	431	8	301	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	8.35e-18	224	446	112	362	Probable beta-xylosidase; Provisional
PRK15098	PRK15098	1.12e-15	224	388	118	287	beta-glucosidase BglX.
pfam14310	Fn3-like	0.003	5	34	39	70	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW78964.1	1.04e-183	3	459	385	844
QIB54448.1	1.04e-183	3	459	385	844
CBL22280.1	2.81e-183	10	453	389	834
QBE97876.1	2.94e-183	3	459	385	844
QJU13871.1	2.33e-179	1	459	383	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	3.14e-73	115	457	2	314	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.47e-72	115	457	2	314	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WUG_A	1.25e-54	224	443	584	815	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5WAB_A	2.28e-52	224	459	69	297	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	2.83e-47	170	460	39	300	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	8.26e-54	10	389	410	770	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
F6C6C1	6.48e-51	224	459	69	297	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.31e-50	224	459	69	297	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P15885	4.41e-49	20	451	367	766	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P14002	1.55e-46	170	460	39	300	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.960595	0.038816	0.000368	0.000093	0.000050	0.000109

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004660_01335.