CAZyme Information: MGYG000004660_01571

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000004660_01571
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365		41643.15	4.6174

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004660	1964208	MAG	China	Asia

• Gene Location: Start: 1196; End: 2293 Strand: -

Full Sequence      

METMVYKGHTPLEYAKMACDTMMKKFKAEDLPPKGRFHYHQGVFLSGVQKTYRLCKEQKY
FDYIKEWIDSIIDENGEIHTFDPGQLDDIQPGILLYDLYKETGDDRYKKALDTLLPLVLN
FPRNAEGGFWHKEGNANEMWLDGLYMGGPIAAQYGAEFDHPEYFDACIYQALMMERNTRD
KKTGLLYHAFDFNRKQPWADPVTGCSPEFWGRSIGWVPVALLDDAEFIPEGYPKRDAMID
VALDLLRAVVKYQDEETGLWYQVVDKGGQDGNWLESSCTCLFTAAICKAVRLGYLDESYL
SYARKGFEGIIDHLKYNENGVIIDNICIGTGVGDYTHYCNRPTSENDLHGAGAFILMCEE
AAQSL

Enzyme Prediction     

No EC number prediction in MGYG000004660_01571.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	361	6.6e-109	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.14e-123	9	356	6	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.85e-110	14	356	1	334	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	8.61e-201	10	362	4	356
BCJ93957.1	2.47e-171	10	360	8	359
AZK46659.1	2.22e-162	10	360	9	359
AEI40556.1	2.47e-162	10	364	9	363
AFH61356.1	5.75e-161	10	360	9	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	1.40e-122	10	360	12	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.73e-122	10	360	2	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	2.59e-85	13	360	3	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	5.28e-27	37	359	65	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.61e-24	37	359	66	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	7.66e-122	10	360	12	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.80e-24	146	361	1	228	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.80e-24	146	361	1	228	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004660_01571.