CAZyme Information: MGYG000004661_00011

Basic Information

• Species: Veillonella dispar
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Veillonellaceae; Veillonella; Veillonella dispar
• CAZyme ID: MGYG000004661_00011
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000004661_1|CGC1	21641.46	9.6877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004661	1456311	MAG	China	Asia

• Gene Location: Start: 10531; End: 11145 Strand: +

Full Sequence      

MELKSKLVITVLTSALAISGIASTQANGPLNNMIRHAALKYNVDPVLLTSLISQESSFNQ
NAVSSAGAIGYGQLMPDTAAELGVNPYDPEQNIDGSARYLRQMLDSNGGNVKLALAAYNA
GQGAVNQYGGIPPYAETQDYVSSVMSGYRDNLATDGALPTPPPAAKPSKTKQGVKKRVVV
YHPSAHSQPTTQKKTNSNVFLYKK

Enzyme Prediction     

No EC number prediction in MGYG000004661_00011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	41	153	6.4e-32	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	1.54e-48	45	149	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	6.14e-39	34	148	10	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	7.17e-36	34	149	8	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	7.54e-35	34	127	1	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	9.96e-29	34	140	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNH53406.1	1.78e-43	26	149	76	199
ANR70806.1	1.01e-42	26	148	76	198
AOH48460.1	1.10e-42	26	149	79	202
BAL82250.1	1.35e-42	26	149	86	209
ASS92357.1	1.84e-41	25	148	42	166

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.00e-10	31	157	418	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.00e-10	31	157	422	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.02e-10	31	157	432	575	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	4.02e-10	31	157	428	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	4.03e-10	31	157	438	581	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.48e-40	30	148	60	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	4.54e-36	11	154	1400	1547	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	4.54e-36	11	154	1400	1547	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	6.71e-17	37	161	14	132	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
P44049	1.77e-09	33	125	192	303	Membrane-bound lytic murein transglycosylase C OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000216	0.999174	0.000171	0.000160	0.000144	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004661_00011.