CAZyme Information: MGYG000004665_00804

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004665_00804
• CAZy Family: GT2
• CAZyme Description: Galactofuranosyltransferase GlfT1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000004665_17|CGC1	34410.08	10.167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004665	1850159	MAG	China	Asia

• Gene Location: Start: 7915; End: 8805 Strand: +

Full Sequence      

MKNKIVAVVVTYNRKDMLKECITALLNQTYHDLDIMVIDNCSTDGTINLVKNINDSRVIY
INTGENLGGAGGFQFGIREALERHYEYFWLMDDDSIPTTRALDGLIKAAQKIKNYGFLSS
KVLWKDHSLCKMNIPKVTINKKLDNFDGKPSRIAMATFVSFFVPAKVVKKVGLPIKEFFI
WADDLEFSRRISRKYPCYFIPDSIIIHKCKTNNGSNIITDEPDRLNRYQYAFRNEVYVYR
REGVVGWLRIIAKPIVQTGKVLLHSKSQKKRRIRIIIHSTFNGFRFKPRIEYYKES

Enzyme Prediction     

No EC number prediction in MGYG000004665_00804.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	119	7.3e-27	0.6588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	3.19e-76	7	238	1	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.92e-50	4	280	4	296	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.69e-31	8	208	2	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	7.30e-23	7	239	1	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
pfam00535	Glycos_transf_2	3.72e-22	8	118	3	112	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIZ04480.1	8.70e-143	1	292	1	292
AEI56585.1	2.49e-142	1	292	1	292
QLL76457.1	2.49e-142	1	292	1	292
QQR14347.1	4.35e-142	1	292	1	292
ANU51692.1	4.35e-142	1	292	1	292

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMX2	1.13e-12	1	270	1	280	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	1.13e-12	1	270	1	280	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1
A0R5Z2	1.51e-12	7	244	9	260	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
Q077R2	9.90e-08	8	126	7	122	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfaP OS=Escherichia coli OX=562 GN=wfaP PE=1 SV=1
Q0P9C6	2.64e-06	4	111	3	110	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004665_00804.