CAZyme Information: MGYG000004667_02283

Basic Information

• Species: Clostridium beijerinckii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium beijerinckii
• CAZyme ID: MGYG000004667_02283
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		60384.78	5.1472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004667	6180974	Isolate	United States	North America

• Gene Location: Start: 96219; End: 97811 Strand: -

Full Sequence      

MRLIKKSSLKNLTIALSAILLGSSLFQTGVSAQAAEGDVIIPVEKKVSTNPVNEVLDENS
TILPASDPENTRKWKLSETMSDEFESSKLDSTKWHDNHIFWSGRQPSCFDSSNVRIENGK
LILRTNYVDEETEAMKKANEKLPEGAPKYKNYSASCVMSTQKTGYGYYEIKAKTAPVSIS
SAFWFRDPKVAKKEIDVFEQVGRAKNNLLSDGSNYPINTHDFEKGEANQISTPCKLYTGI
DLTADHHIYGLEWDENFLRFYIDGKIVHEIKNVSMKQALYTIFDMESFVYDVIPADKEDF
KYVNGRFTGDYEIEYFRVWRSDVPQSTELSDVETNRTPQAKLAVALYGSPNITTNSTKID
PIWEKAAYVGKMHAKGGDPQINAKVKTMWDEDYLYVLVDVDDKDIYAKADCTELYIDGGN
EKVNGPYDANDYFIKIFPDGNVEKHKNTPEGCIFNSILKSDKSGYYTQYKIPIKDVQNKD
NKVIGFDIQINDGDSKREFRRGYIGWNDTRDNAWYSLYTTGNLYLMKLEK

Enzyme Prediction     

No EC number prediction in MGYG000004667_02283.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	81	319	1.2e-58	0.9955357142857143
CBM9	359	525	2.8e-29	0.9725274725274725

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02178	GH16_beta_agarase	8.08e-60	64	320	9	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd00005	CBM9_like_1	2.46e-27	342	526	1	185	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.
pfam06452	CBM9_1	2.03e-23	358	525	4	181	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd00413	Glyco_hydrolase_16	6.11e-23	82	319	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	8.20e-18	81	284	2	198	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGG56400.1	6.30e-106	52	525	179	638
AXT50244.1	5.12e-41	38	319	21	284
CAL66698.1	5.26e-41	38	320	23	287
AXT60531.1	2.01e-40	34	320	19	287
AXT54175.1	5.65e-40	38	322	23	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ATE_A	1.36e-24	68	290	12	227	Highresolution crystal structure of beta-porphyranase A from Zobellia galactanivorans [Zobellia galactanivorans]
3ILF_A	1.98e-22	68	290	14	229	Crystalstructure of porphyranase A (PorA) in complex with neo-porphyrotetraose [Zobellia galactanivorans]
3JUU_A	1.50e-19	64	296	16	253	Crystalstructure of porphyranase B (PorB) from Zobellia galactanivorans [Zobellia galactanivorans],3JUU_B Crystal structure of porphyranase B (PorB) from Zobellia galactanivorans [Zobellia galactanivorans]
1I82_A	3.34e-18	342	527	2	189	Family9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Cellobiose [Thermotoga maritima],1I8A_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a With Glucose [Thermotoga maritima],1I8U_A Family 9 Carbohydrate-Binding Module From Thermotoga Maritima Xylanase 10a [Thermotoga maritima]
4AWD_A	5.80e-18	73	337	47	309	ChainA, BETA-PORPHYRANASE [Phocaeicola plebeius],4AWD_B Chain B, BETA-PORPHYRANASE [Phocaeicola plebeius]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7GXG0	1.60e-22	68	290	23	238	Beta-porphyranase A OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porA PE=1 SV=1
D7GXG3	3.35e-21	73	298	28	255	Beta-porphyranase E OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porE PE=3 SV=1
D7GXF9	1.02e-18	64	296	29	266	Beta-porphyranase B OS=Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij) OX=63186 GN=porB PE=1 SV=1
O69230	1.15e-18	277	527	823	1085	Endo-1,4-beta-xylanase C OS=Paenibacillus barcinonensis OX=198119 GN=xynC PE=1 SV=1
P38535	1.45e-17	340	525	709	894	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000318	0.998942	0.000208	0.000202	0.000161	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004667_02283.