CAZyme Information: MGYG000004667_02707

Basic Information

• Species: Clostridium beijerinckii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium beijerinckii
• CAZyme ID: MGYG000004667_02707
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661	MGYG000004667_54|CGC1	72116.41	6.9111

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004667	6180974	Isolate	United States	North America

• Gene Location: Start: 38969; End: 40954 Strand: +

Full Sequence      

MKAIKRSTTLFFAFVIVLILIPITSVKAAITDIKIVSETKVTAKQAEQWAKSKGATDAFI
NLAKLYWKYSPEHGNVNPAVAYVQAAKETGYGKFGGVINESYHNPCGLKISAGGLDNDPN
AHQKFNTWDEGVQAHLDHLALYAGVDGYPRSDSYDPRDFITIKGTVVTVNALGGKWAPSL
TYGEEVNQLYNDLLVSAGIVSKSDNDTSKNSGSDNDSGKTVGTDKPQTNTTVPTGMEATK
PIPASPDGSKGISSSIGWRFENGNWYYYNSDGSKVTGWIKPDGNWYYLYSDGSMAKGWSL
LRGKWYYFKSSGAMQLGWIKDSNKWYYLQGDGSMITGFNLIDGRKYFLDSSGAMKTGWVS
ISGQWYYFNSDGSMLTGWVKPDGSWYYLYSNGVMATNWLQLNGTWYYLRSNGTMATGWIL
SGNAYYYLLPVSGAMAKNTVVNGWQIGEDGKRGDRMPGSTNGKVIVIDPGHNFGGDDGAY
STNDGITYSERDLNMQVADKLKEKLEANGYTVIMTRKSSDREVLGVNQSLTNRVNIANNS
KADLFISLHHNSADAESARGVEVYYSSKSQDESFGGGYSYDRLSKSMNVASSIASSLTNS
TGAINRGAKDGNLFVCRNTTMPAVLVELGFITNTDEAKKCADSSYQDVEATAIANAVSTI
I

Enzyme Prediction     

No EC number prediction in MGYG000004667_02707.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	1.90e-82	233	450	420	657	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	2.66e-71	243	451	478	681	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
cd02696	MurNAc-LAA	4.63e-68	464	657	1	171	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino acids in certain cell wall glycopeptides. These proteins are Zn-dependent peptidases with highly conserved residues involved in cation co-ordination. MurNAc-LAA in this family is one of several peptidoglycan hydrolases (PGHs) found in bacterial and bacteriophage or prophage genomes that are involved in the degradation of the peptidoglycan. In Escherichia coli, there are five MurNAc-LAAs present: AmiA, AmiB, AmiC and AmiD that are periplasmic, and AmpD that is cytoplasmic. Three of these (AmiA, AmiB and AmiC) belong to this family, the other two (AmiD and AmpD) do not. E. coli AmiA, AmiB and AmiC play an important role in cleaving the septum to release daughter cells after cell division. In general, bacterial MurNAc-LAAs are members of the bacterial autolytic system and carry a signal peptide in their N-termini that allows their transport across the cytoplasmic membrane. However, the bacteriophage MurNAc-LAAs are endolysins since these phage-encoded enzymes break down bacterial peptidoglycan at the terminal stage of the phage reproduction cycle. As opposed to autolysins, almost all endolysins have no signal peptides and their translocation through the cytoplasmic membrane is thought to proceed with the help of phage-encoded holin proteins. The amidase catalytic module is fused to another functional module (cell wall binding module or CWBM) either at the N- or C-terminus, which is responsible for high affinity binding of the protein to the cell wall.
COG0860	AmiC	2.61e-58	457	657	37	224	N-acetylmuramoyl-L-alanine amidase [Cell wall/membrane/envelope biogenesis].
pfam01520	Amidase_3	5.25e-58	465	657	1	172	N-acetylmuramoyl-L-alanine amidase. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIU03413.1	2.64e-315	1	661	1	661
ABR36806.1	2.64e-315	1	661	1	661
QUF73799.1	2.64e-315	1	661	1	661
AQS07558.1	3.06e-314	1	661	1	661
AJH01761.1	2.49e-313	1	661	1	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RN7_A	3.20e-20	460	657	1	178	ChainA, N-acetylmuramoyl-L-alanine amidase [Clostridioides difficile 630]
1JWQ_A	4.82e-18	463	658	2	173	Structureof the catalytic domain of CwlV, N-acetylmuramoyl-L-alanine amidase from Bacillus(Paenibacillus) polymyxa var.colistinus [Paenibacillus polymyxa]
7RAG_B	3.23e-16	463	653	17	201	ChainB, Germination-specific N-acetylmuramoyl-L-alanine amidase, Autolysin [Clostridioides difficile]
5J72_A	5.93e-15	458	639	447	615	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
5EMI_A	1.98e-14	464	657	6	174	ChainA, Cell wall hydrolase/autolysin [Nostoc punctiforme PCC 73102]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54525	6.74e-21	462	659	29	202	Uncharacterized protein YqiI OS=Bacillus subtilis (strain 168) OX=224308 GN=yqiI PE=3 SV=3
Q02114	4.80e-19	451	653	308	487	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1
Q8CP02	2.33e-16	462	653	119	281	Probable cell wall amidase LytH OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=lytH PE=3 SV=1
P50864	3.11e-16	461	653	39	221	Germination-specific N-acetylmuramoyl-L-alanine amidase OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlD PE=1 SV=1
Q5HNS0	3.15e-16	462	653	119	281	Probable cell wall amidase LytH OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=lytH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.999077	0.000154	0.000178	0.000155	0.000147

TMHMM  Annotations     

start	end
7	26