CAZyme Information: MGYG000004667_03455

Basic Information

• Species: Clostridium beijerinckii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium beijerinckii
• CAZyme ID: MGYG000004667_03455
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
149	MGYG000004667_67|CGC2	17616.76	9.7918

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004667	6180974	Isolate	United States	North America

• Gene Location: Start: 43474; End: 43923 Strand: +

Full Sequence      

MKVCFITSSGGHLTHLIQLKEWWKDKERFWVTFEKEDSKSILKDEKKYWCYFPTNRNIKN
LIKNTFLSIKILLKEKPDLIVSTGAAPAIPFFYIGKLFGAKVVYIEVYDRIEKPTITGKI
VYPISDLFILQWEEQKKFYPRGQVLEGLF

Enzyme Prediction     

No EC number prediction in MGYG000004667_03455.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08660	Alg14	4.40e-20	3	141	1	164	Oligosaccharide biosynthesis protein Alg14 like. Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane.
COG0707	MurG	1.25e-14	1	144	1	156	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	1.60e-04	56	144	69	154	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd01143	YvrC	0.005	50	121	33	108	Periplasmic binding protein YvrC. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria and archaea. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUN34891.1	2.97e-109	1	149	1	149
AQS07597.1	4.22e-109	1	149	1	149
AVK48663.1	4.22e-109	1	149	1	149
ALB44153.1	4.22e-109	1	149	1	149
AJH01801.1	4.22e-109	1	149	1	149

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q96F25	7.90e-09	62	145	123	212	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens OX=9606 GN=ALG14 PE=1 SV=1
Q9D081	2.90e-08	66	145	128	213	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Mus musculus OX=10090 GN=Alg14 PE=1 SV=1
Q5A5N6	2.96e-08	57	141	121	211	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ALG14 PE=3 SV=1
Q6AY85	7.56e-08	66	145	127	212	UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus OX=10116 GN=Alg14 PE=2 SV=1
Q6CF02	1.98e-07	67	143	128	210	UDP-N-acetylglucosamine transferase subunit ALG14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004667_03455.