CAZyme Information: MGYG000004668_00599

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus
• CAZyme ID: MGYG000004668_00599
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000004668_10|CGC1	80720.87	4.7303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004668	1185526	MAG	China	Asia

• Gene Location: Start: 15107; End: 17314 Strand: -

Full Sequence      

MVKIDLDFVEGLTLEERAALVSGKDFWFTAKVPGVERMMMSDGPSGLRKQDVDASPVDVN
DSVDAVCFPSSALTASSFDDQMLYKLGQHLGIAANAEHLGVLLGPGVNIKRSPLAGRNFE
YFSEDPLLAGRMGTAYVKGVQDQGVGVSVKHFAANNRENQRFTSSSNIDERTLREIYLAQ
FERIVKEAHPATLMCSYNRLNGTLNSQNQRLLTEILRDEWGFEGLVMSDWGAVADHVATL
KAGLDLEMPGRGQASVDEIVTAVKEGRLQESTLNRSALRVLKMVEKWGKKVTKADPYDKE
EQHNFARQMADDSIVLLKNEDHQLPLDSNDSLAVIGELAAKPRFEGGGSSHVNAHHVVTP
LDAAPAGAKYAQGYSLDTTQADDQLVSAAVELAKNSQRVVYFAGFPEKMETEGFDKDTIS
LPANQNELLTKIVAVNPNVTVVLQNGSVVAMPWADQVPAIVETYLAGEAVGEATWDILTG
KVNPSGKLSESFPLRLADNPTYGTFAKDHDEEDYHEGLFVGYRYYDLHAMPVRFPFGHGL
SYTQFDYGDLTVNEESDSVKVTFTVTNTGKVAGKEAAQVYVANHISRVEMPVKELRDFAK
VALQPGESKTVTVNLSRRAFSYYNVAKQQWEADNGAYEIMVGSSSRDIRLTTDFTLTIGV
NPLGTITGDTYVGDVWVDKDPRVQAALKESGLYEILEPMMKDEQWVAISANMPLRSLAAM
GISEQARQAFFDALK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	249	7.2e-63	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.41e-87	68	656	120	764	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	3.66e-60	314	522	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	9.00e-57	65	613	111	740	Probable beta-xylosidase; Provisional
COG1472	BglX	2.71e-55	65	373	80	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.29e-34	68	281	88	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMS07885.1	0.0	1	735	1	735
QZN93572.1	0.0	1	735	1	735
AJT51049.1	0.0	1	725	1	722
QLI93846.1	0.0	1	725	1	722
AMS08576.1	0.0	1	732	1	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.51e-218	9	717	9	731	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.12e-186	9	717	9	724	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.14e-120	1	654	1	834	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.84e-116	3	654	3	834	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	4.43e-114	7	656	6	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.85e-218	9	734	9	751	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	4.55e-184	9	720	9	736	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.45e-179	9	720	9	736	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BB53	7.50e-130	1	654	1	828	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
P27034	4.73e-129	7	658	4	812	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004668_00599.