CAZyme Information: MGYG000004670_01113

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004670_01113
• CAZy Family: GT21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000004670_207|CGC1	36880.45	9.1296

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004670	1940702	MAG	China	Asia

• Gene Location: Start: 2260; End: 3291 Strand: -

Full Sequence      

MIIPAAGNDPRMEAALRSLLRQDYPDLLPVIVTSGEDDPAVGIIRRLREDFPALRHVVAG
EARDCGQKNRNSLAGVAAVGDAADIYLFCDSTHMAGPEFARCLAGPLARHEAAFSTGYHE
VEPRDHGTVTLAYALSVLLMRLLQGVAAFTQPWGGAMGMTRAAFERYGVARLWATNVVDD
CSLGAMLQARGVHVRLCAAALLRTTASGHAFGVWRAWMERQVLFLKFCMPGQWLLLGVLA
VLMLAPPLWACIVLGGGLLGLGGGAAPFLALCWLVLLAGILSGWRRLLPVAVPPGRWLGA
FFCAAGLFAWVYAATIPARTIAWRHMVYVVGKGGVLLGMRRRG

Enzyme Prediction     

No EC number prediction in MGYG000004670_01113.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT21	2	221	8.3e-20	0.944206008583691

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13506	Glyco_transf_21	5.97e-24	56	226	6	174	Glycosyl transferase family 21. This is a family of ceramide beta-glucosyltransferases - EC:2.4.1.80.
cd02520	Glucosylceramide_synthase	1.56e-09	1	196	5	168	Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis. UDP-glucose:N-acylsphingosine D-glucosyltransferase (glucosylceramide synthase or ceramide glucosyltransferase) catalyzes the first glycosylation step of glycosphingolipid synthesis. Its product, glucosylceramide, serves as the core of more than 300 glycosphingolipids (GSL). GSLs are a group of membrane components that have the lipid portion embedded in the outer plasma membrane leaflet and the sugar chains extended to the outer environment. Several lines of evidence suggest the importance of GSLs in various cellular processes such as differentiation, adhesion, proliferation, and cell-cell recognition. In pathogenic fungus Cryptococcus neoformans, glucosylceramide serves as an antigen that elicits an antibody response in patients and it is essential for fungal growth in host extracellular environment.
COG1215	BcsA	7.94e-08	2	330	59	426	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.44e-07	2	205	7	212	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd00761	Glyco_tranf_GTA_type	2.35e-06	2	58	2	58	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD89420.1	7.75e-173	1	342	50	391
QCC85255.1	1.64e-138	1	341	50	390
SPD34223.1	2.26e-136	1	341	50	390
ATD81518.1	2.26e-136	1	341	50	390
QTO41435.1	2.88e-135	1	337	50	386

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
233	255
260	282
297	316