CAZyme Information: MGYG000004676_00919

Basic Information

• Species: Bacteroides sp900766005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766005
• CAZyme ID: MGYG000004676_00919
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000004676_8|CGC1	35494.49	9.8472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004676	1765238	MAG	China	Asia

• Gene Location: Start: 81292; End: 82221 Strand: +

Full Sequence      

MPLFNSPTEPVKKKKKSGSVSQKKKSGTASSRKRGTASAAKTRSVKTVQMKQDEGMSAWQ
RNTLAVLLVVVFSFLFYYFFIRPYEYRWKPCNGLKDYGVCIPYGYQVHGIDVSHYQGRID
WQLLQQHQEAITPLQFVFMKATEGGDHGDTTFASHFANARAHGFIRGAYHFFIPGTDALR
QAEFFIQTVKLDTGDLPPVLDVEVTGRKSKQELQQGIIRWLNRVEAHYGVKPILYTSYKF
KKKYLNDSVFNAYPYWIAHYYVDSVRYEGRWDFWQHTDVGSVPGIEEEVDLNVFNGSLAD
LKALTIQKK

Enzyme Prediction     

No EC number prediction in MGYG000004676_00919.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	110	285	1.3e-55	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	8.51e-91	108	296	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	1.71e-72	105	296	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	1.73e-68	110	285	1	180	Glycosyl hydrolases family 25.
cd00599	GH25_muramidase	1.14e-63	108	294	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG3757	Acm	1.77e-59	95	309	51	268	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95417.1	1.37e-158	1	307	1	297
QUU08677.1	7.88e-158	43	307	33	297
QQT77138.1	1.12e-157	43	307	33	297
ASM67896.2	1.12e-157	43	307	33	297
QRP57616.1	1.12e-157	43	307	33	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	2.16e-29	105	297	14	209	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	8.54e-26	107	304	5	212	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
6ZMV_A	1.76e-17	107	304	2	203	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
2X8R_A	7.20e-11	107	304	4	207	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]
3HMC_A	3.53e-10	108	297	6	182	Endolysinfrom Bacillus anthracis [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	1.34e-55	86	303	49	263	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	3.78e-55	86	302	49	262	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	1.50e-54	86	303	49	263	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	2.28e-24	107	304	82	289	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	6.51e-23	109	302	11	204	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999862	0.000145	0.000003	0.000000	0.000000	0.000003

TMHMM  Annotations     

start	end
59	81