CAZyme Information: MGYG000004676_01437

Basic Information

• Species: Bacteroides sp900766005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900766005
• CAZyme ID: MGYG000004676_01437
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000004676_22|CGC1	37555.44	9.6347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004676	1765238	MAG	China	Asia

• Gene Location: Start: 3468; End: 4454 Strand: -

Full Sequence      

MNIQKLKKSGFIISLIGAAGIGALLPTLMSNSAMDHPQKIHSEVPYCVTSLSVPEQVVFD
GKIIDLTRYDRRERMDRELSSFTFMHSTTMLLIKRANRYFPIVEPILKANGIPDDFKYLM
VIESSLNHIARSPAGAAGLWQFMPATGREFGLEVNSNVDERYHIEKATVAACKYFKQAYA
KYGDWMAVSAAYNAGQARISSQLSKQLASHAMDLWLVEETSRYMFRLLAVKEVFSHPQRY
GFLLKKEQLYPVIPHTEITVNSPIDNLYEFAKEQGITYAQLRDANPWLREMSLKNKTGKK
YVIHIPTREGMYYNPKKTVPYNKHWVID

Enzyme Prediction     

No EC number prediction in MGYG000004676_01437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	99	233	2.4e-21	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	9.83e-62	107	232	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	8.24e-25	72	286	81	293	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	3.80e-22	102	206	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	5.31e-17	119	198	7	84	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.80e-14	99	229	6	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA49012.1	4.15e-192	2	328	7	333
QUT70157.1	4.56e-192	3	328	1	326
QMW86815.1	1.19e-191	2	328	7	333
AAO79592.1	1.19e-191	2	328	7	333
ALJ43129.1	1.31e-191	3	328	1	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	5.94e-23	72	310	78	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	5.94e-23	72	310	78	312	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.796120	0.199642	0.001632	0.000828	0.000422	0.001375

TMHMM  Annotations     

start	end
9	31