CAZyme Information: MGYG000004680_00297

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora
• CAZyme ID: MGYG000004680_00297
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746	MGYG000004680_3|CGC1	80740.7	6.0628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004680	3596809	MAG	Germany	Europe

• Gene Location: Start: 39655; End: 41895 Strand: -

Full Sequence      

MKKRKGRMFFVVSVLINLFIFCLGGERVEAASSYYVSVTGNDATGTGTLANPWKTIQKAA
DSMKAGDTCIIRGGTYRETVTMKTSGTSAKPISFQAYKGETVTVSGADPVTDWVKDSGSI
YYASMNGSLGTKDQIFVNKQMQIQARWPNSAQQNPMNATFASVDSGSASMIQDESLTQKA
GYWVGKTVWCVSGTGYKSYQSTITGSNPGSITFDPIEIPAAAGNSYYITGDLNDLDSPGE
WYYDSPTDRLYLWAPGGENPNNLTVEAKKRTYAFDLSSRSYINITGINIFASSIKMAGSN
SCKVSDLKGEYISHDSDVTKQYSTGIFMSGTNNELRDSTLTYSSGNLVSIQGTGNQLINN
LIHEADYSAADIPAIYLLGANHLISHNTVYNAGRHLIFMPTQNSRIQYNDLYNAGKLTKD
CGILYEFAWDGQGTVIHHNYIHDNLAKNYSGTGIYLDNGSKNYIVHHNVVWGNYTGIRLN
TPSNFNLIYNNTTYNNGNIGYWGSKFQSDMYGDRIFNNIFTTAFTLPGTHIEGNNITSGT
DPLFENPAAGDFRLKAASPAVDAGVVIPGITGDYAGSGPDIGAYEYGGSKWTPGHDFSFP
PDPVFEDVSVLYINKVRQSDLEKGVISPWVPTHSKTAAGVSVSRSGSKSVRLGTGEDGIK
QTVTGLSPNTTYVCTAWVKADPGEQVEIGVNGFGGTKVSQTSDRTDWTMVQIPFTTGAGA
VNATVYAYKKSGAAYVYVDDFGVAEQ

Enzyme Prediction     

No EC number prediction in MGYG000004680_00297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	33	267	1.6e-27	0.4819734345351044
CBM16	616	728	4.1e-18	0.9655172413793104

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.03e-13	324	488	1	153	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	5.11e-07	322	491	18	170	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam02018	CBM_4_9	1.44e-06	614	726	2	127	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
pfam05048	NosD	7.22e-05	342	488	16	144	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	0.001	374	491	2	108	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHM67318.1	0.0	1	746	1	746
AIY08095.1	0.0	1	746	1	746
AJE52964.1	0.0	1	746	1	746
QOH63199.1	0.0	1	746	1	746
AZH30628.1	0.0	1	746	1	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VST_A	5.15e-11	34	128	3	97	Thecomplex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_B The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_C The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VST_D The complex structure of XylC with Tris [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_A The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_B The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_C The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSU_D The complex structure of XylC with xylobiose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_A The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_B The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_C The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485],3VSV_D The complex structure of XylC with xylose [Thermoanaerobacterium saccharolyticum JW/SL-YS485]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	8.55e-17	585	741	260	417	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P94576	2.74e-10	11	106	12	107	Uncharacterized protein YwoF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywoF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000584	0.992681	0.006084	0.000249	0.000184	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004680_00297.