CAZyme Information: MGYG000004680_00559

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora
• CAZyme ID: MGYG000004680_00559
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000004680_5|CGC1	43361.26	8.0598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004680	3596809	MAG	Germany	Europe

• Gene Location: Start: 52843; End: 53997 Strand: -

Full Sequence      

MKQLLKKMVTVVSVMTLTISSLGVTQTAAADQTLLNTYGSKFERAGTCVSLNQLQNSSTL
NIIKQRYNSITLENEMKPDAMLGSSPKLIPVAEARSLGYYIPDNYTEATVPRINFNTVDK
VLKICYENGLGVRAHTLVWHSQTPSWLFRTGYSAGGAYVSQAVMNARMEFYIKTVMNHIY
ISDYGSVVYAWDVVNEYLHSPANSDWVRIYGSVTTSPQFVKDAFRYANETLNYFKLTDKV
SLFYNDYNEYMEASNIIKMIQFINSDKKICNGVGGQSHLASNFPSASYYKQAYTAFMNAG
LEIQITEFDAGANSEQEQAAYVYDIMKTICEVKKAGGKITGITWWGLSDDVSWRREKSPL
LFSNLWTPKASYYKTLDAYTDVFR

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	38	378	5.9e-83	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	4.08e-68	105	373	5	261	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.93e-66	38	377	5	310	Glycosyl hydrolase family 10.
COG3693	XynA	1.21e-49	45	373	36	335	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFU34339.1	6.00e-165	11	381	151	522
BCJ93966.1	2.36e-160	28	381	161	515
ABX41884.1	4.87e-152	31	381	167	517
AQS12857.1	2.68e-151	30	381	34	394
AGX41685.1	2.68e-151	30	381	34	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W5F_A	3.20e-47	29	372	179	521	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2W5F_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
2WYS_A	1.63e-45	29	372	179	521	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WYS_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],2WZE_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
5OFJ_A	3.15e-39	34	378	11	338	Crystalstructure of N-terminal domain of bifunctional CbXyn10C [Caldicellulosiruptor bescii DSM 6725]
6D5C_A	3.99e-39	46	378	34	350	Structureof Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_B Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5C_C Structure of Caldicellulosiruptor danielii GH10 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
5OFK_A	2.31e-38	34	378	11	338	Crystalstructure of CbXyn10C variant E140Q/E248Q complexed with xyloheptaose [Caldicellulosiruptor bescii DSM 6725],5OFL_A Crystal structure of CbXyn10C variant E140Q/E248Q complexed with cellohexaose [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23551	1.09e-125	29	383	33	387	Endo-1,4-beta-xylanase A OS=Butyrivibrio fibrisolvens OX=831 GN=xynA PE=3 SV=1
P29126	8.56e-53	40	376	635	950	Bifunctional endo-1,4-beta-xylanase XylA OS=Ruminococcus flavefaciens OX=1265 GN=xynA PE=3 SV=1
P51584	6.82e-46	29	372	190	532	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P26223	1.12e-39	35	378	3	337	Endo-1,4-beta-xylanase B OS=Butyrivibrio fibrisolvens OX=831 GN=xynB PE=3 SV=1
P40944	2.38e-37	44	377	365	677	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor sp. (strain Rt8B.4) OX=28238 GN=xynA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000214	0.999158	0.000158	0.000166	0.000143	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004680_00559.