CAZyme Information: MGYG000004680_01937

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora
• CAZyme ID: MGYG000004680_01937
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878	MGYG000004680_24|CGC1	101091.33	5.1949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004680	3596809	MAG	Germany	Europe

• Gene Location: Start: 44534; End: 47170 Strand: -

Full Sequence      

MKLHNLGDRQKTGYTTWGCMWQQGACKKETGYVLKNDDGKSVPMQSRITAYWPDGTVKWT
AHTACADELTEEIEVIPFEETAGERNGGSRGLYVKPEGTGYVVDAGGLRIHIPGPGDCLF
DEVWAGGIKRISKACPVLLLEEPITYAGAKGRLLKTYRGVVEEVSLDEEGPLRAVIKYRG
IHVSSTGERKLPFLIRMYVGLDKRELSFTHTFLYDGEEEKDFLKGIGLQFFVPLKGAMYH
RHVMFEGDHGVFHETMAELLTWRPRVPLEIYHAQMNGERLNLKGSDREVVETVLNDMPFW
DEYDLCQDSPSHFRIKKKTALPDCCYLDSLHGRRTMGGAAFGGENGSVICSLRDFWQTYP
SGYTFRGLTGEEAEAVIWLYSPGAEAMDFRHYTDRGYNQVYYEGYDYKGATPYGIASTSQ
YAIAFCDSLIPSEEELCSFSKAVSNPAQYVGTPEFYHEHRAFGYWSLPSRETEMECWLEE
QLDRAVDFYRGEVEQRNWYGLFNYGDFMHTYDMERHQWRYDMGGYAWDNTELVPTLWLWL
AFLRSGRPEIFALAEKLTRHASEVDVYHMGKYKGLGSRHNVRHWGCPCKEARIAMAAHHR
YYYYMTGDYRLEDIFDELKDNEQTFLYKDPLADFYKKEEMVYQSHARSGPDWSSLCANWM
TQWERFLDDRYLKKIQVGMEDIKNAPLKLLSGPDFEFDPETVHLRYIGERAAGGTHLQIC
MGAPQIFMEMADLIGDEEWKQMMAEYGRFYFLLREQQVKESGGLIGDREFSLPFMAAAMG
AYGAWYLKNDDLAKTTWCHLLHALLCEENHNGFRITKLSSKGNQEELSEIPWISTNFTAQ
WCLNVICVLDFIKEQLPNDLKEADELVAAMPSDSFRKA

Enzyme Prediction     

No EC number prediction in MGYG000004680_01937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	10	856	2.6e-298	0.9872389791183295

CDD Domains     

MGYG000004680_01937 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ94257.1	0.0	20	878	1	854
AEC02734.1	0.0	1	878	3	911
ABX43437.1	0.0	1	857	5	874
AOZ96961.1	2.35e-317	1	861	1	861
AGC67247.1	1.60e-251	1	859	5	854

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	1.24e-135	3	856	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	1.84e-134	3	856	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	1.94e-134	3	856	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	7.10e-134	3	856	10	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	1.30e-223	7	857	9	847	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999970	0.000073	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004680_01937.