CAZyme Information: MGYG000004680_02711

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lacrimispora
• CAZyme ID: MGYG000004680_02711
• CAZy Family: GH106
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
862	MGYG000004680_47|CGC1	99024.15	5.7473

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004680	3596809	MAG	Germany	Europe

• Gene Location: Start: 8787; End: 11375 Strand: -

Full Sequence      

MKRLNEVLKGNADNYILPFLWLHGEEESVLRETVEKIHESGIRAFCVEARPHPDFLGETW
WRDMDILLEEAKQRNMKVWILDDSHFPTGYADGRVEREFPHLQKQFLACKVLDFIGPMKN
AQAIIRYAFRDKKDKLISVTLGKKTGYQKIDPDTLIDITGQVVNHTLVSFDLPKGDWSVM
IVTATFEGGEPETKGYLNPIDPLATDVLIDTVYEAHYEKYKEEFGKTIAGFFSDEPRFGN
MHGATGSIGRTEMDIPWREDLLELLEKQTGTDCRKRLPLLFLEGGEPGHQIRYEYMDLVS
KLYSKHFNKRISDWCARHQVEYIGHTIEDNNAHARLGYGAGHFFRAMAHQDMAGIDVVFH
QLMPGMDGGIFKSKTKAGWDGEFFHYVLGKLGSSLAHMDPKKQGRALCEVFGAYGWAEGN
RLMKWIIDYMMVRGINYYVPHAFDPKEYPDCDCPPHFYAHGRDPQFGGFRLLMDYTNRLS
HLLSGGIHKAPVALLYHGEAEWSGEYMLMQKPAKELTRNQIDFDILPIDGLMEAEVSESG
IKVNQETFQGLVLPYAEALPGKFLKWLLKASEHGLYLYWLKDLPNRTSQGEDACEIIKQL
KASSSVRIVSLETLAETIRSDGLNEISVNTDVPYLRYYHYEQEDGHIYFFVNEHPYDAVT
AEVKVSNKGPCFAYCAMENKRKEDSSPLTLNLSPYESKMVIFPRSMNDFLPAPKEYEKVS
EYQVKGPYQVSFATYPDFTEFKEPMMLEKLRPLQEIKGKEEFTGMIRYEFEAELWKTDQV
IAAVEGVAEGVKVWVNEIFIGEKICPPYRFDITKALKEGKNRFCIQVSTTLVRERYDYLS
QFMLLEPTGITGSITVEHYIVK

Enzyme Prediction     

No EC number prediction in MGYG000004680_02711.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH106	30	831	1.6e-68	0.9101941747572816

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02837	Glyco_hydro_2_N	7.54e-04	763	827	66	133	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
cd13300	PH1_TECPR1	0.001	637	690	47	95	Tectonin beta-propeller repeat-containing protein 1 Pleckstrin homology (PH) domain, repeat 1. TECPR1 is a tethering factor involved in autophagy. It promotes the autophagosome fusion with lysosomes by associating with both the ATG5-ATG12 conjugate and phosphatidylinositol-3-phosphate (PtdIns3P) present at the surface of autophagosomes. TECPR1 is also involved in selective autophagy against bacterial pathogens, by being required for phagophore/preautophagosomal structure biogenesis and maturation. It contains 2 DysFN (Dysferlin domains of unknown function, N-terminal), 2 Hyd_WA domains that is a probably beta-propeller, a PH-like domain, a TECPR domain, and a DysFC (C-terminal). The PH domain mediates the binding to phosphatidylinositol-3-phosphate (PtdIns3P). Binding to the ATG5-ATG12 conjugate exposes the PH domain, allowing the association with PtdIns3P. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQR97289.1	0.0	1	859	1	861
AGF58598.1	0.0	1	859	1	861
AIY07063.1	0.0	1	859	1	888
APQ61832.1	0.0	1	854	1	865
AHM66104.1	0.0	1	838	1	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQM_A	8.79e-07	172	830	390	1056	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron],5MQN_A Glycoside hydrolase BT_0986 [Bacteroides thetaiotaomicron]
5MWK_A	8.79e-07	172	830	390	1056	Glycosidehydrolase BT_0986 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004680_02711.