CAZyme Information: MGYG000004682_01104

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004682_01104
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22315.95	4.4429

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004682	1336942	MAG	China	Asia

• Gene Location: Start: 761; End: 1363 Strand: -

Full Sequence      

MPFSSPDSSYGSWTQGPGLKFFRTLEEKLGTLPIIAEDLGFLTPGVIDMRDNSGFPGMKI
LQFAFEGANSYYLPHNYIANTVAYVGTHDNETARGWFEGTATPRQREQAALYTHQQAGEP
MADALNRTIAASVSDTCIYTMQDLLNLGNEARINTPATLGGNWTWRMLDGAITRELEHKL
TDWTETFFRIPSEAEIELPQ

Enzyme Prediction     

No EC number prediction in MGYG000004682_01104.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	5	184	6.4e-53	0.38461538461538464

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14508	PRK14508	4.09e-85	11	190	318	497	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	4.52e-68	2	167	289	457	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PLN02635	PLN02635	4.00e-56	2	196	335	532	disproportionating enzyme
COG1640	MalQ	6.03e-46	11	195	324	520	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
TIGR00217	malQ	2.27e-35	11	168	332	492	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54274.1	6.00e-142	1	200	302	501
QIA34781.1	6.00e-142	1	200	302	501
AZH70365.1	2.43e-141	1	200	302	501
AFA54836.1	1.84e-138	1	200	302	501
AKT47809.1	3.51e-91	1	199	301	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M6T_A	3.07e-45	11	189	317	496	ChainA, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_B Chain B, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_C Chain C, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_D Chain D, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_E Chain E, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_F Chain F, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_G Chain G, 4-alpha-glucanotransferase [Streptococcus agalactiae],6M6T_H Chain H, 4-alpha-glucanotransferase [Streptococcus agalactiae]
2OWC_A	1.11e-43	1	190	307	502	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]
1CWY_A	5.71e-43	1	190	304	500	CrystalStructure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans [Thermus aquaticus],1ESW_A X-Ray Structure Of Acarbose Bound To Amylomaltase From Thermus Aquaticus. Implications For The Synthesis Of Large Cyclic Glucans [Thermus aquaticus]
1FP8_A	5.71e-43	1	190	304	500	StructureOf The Amylomaltase From Thermus Thermophilus Hb8 In Space Group P21212 [Thermus thermophilus],1FP9_A Structure Of Amylomaltase From Thermus Thermophilus Hb8 In Space Group C2 [Thermus thermophilus]
2X1I_A	7.96e-43	1	190	304	500	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59266	3.73e-54	1	189	296	485	4-alpha-glucanotransferase OS=Clostridium butyricum OX=1492 GN=malQ PE=1 SV=1
P0A3Q0	1.55e-52	1	190	306	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malQ PE=3 SV=1
P0A3Q1	1.55e-52	1	190	306	496	4-alpha-glucanotransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=malQ PE=3 SV=1
O87172	3.13e-42	1	190	304	500	4-alpha-glucanotransferase OS=Thermus thermophilus OX=274 GN=malQ PE=1 SV=1
Q9LV91	1.04e-37	1	167	384	550	4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic OS=Arabidopsis thaliana OX=3702 GN=DPE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004682_01104.