CAZyme Information: MGYG000004685_00793

Basic Information

• Species: CAG-245 sp900758165
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-245; CAG-245 sp900758165
• CAZyme ID: MGYG000004685_00793
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239	MGYG000004685_14|CGC1	27248.28	7.9237

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004685	1257965	MAG	China	Asia

• Gene Location: Start: 21863; End: 22582 Strand: +

Full Sequence      

MKFFRRLLLFILIALIIIGSVFYMNGKKLYDKKISEISLSDKIQSIRESDNFVPLSSIPS
YYKKAVVDVEDHRFYKHGAVDFIALARATVSNIKQKDFKEGGSTITQQTAKNLYFIEEDD
VTSRKPAEIILSQKMEKAYSKDEILEIYINTIYFGDGYYGIKEACNGYFKKDPKDMTLYE
ATMLAGIPNAPSVYAPTVNFNLTKSRQKKVVSSMVENGDLYEDEANALYKEIDSATFSK

Enzyme Prediction     

No EC number prediction in MGYG000004685_00793.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	45	215	2.7e-59	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	2.27e-73	53	215	16	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.99e-66	28	231	57	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.09e-65	52	231	4	182	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	1.38e-55	52	231	69	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	2.86e-41	41	214	36	223	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM09777.1	1.66e-71	6	232	19	244
SET89048.1	5.14e-69	3	232	6	234
QUO38940.1	1.29e-68	6	228	10	231
ANU46909.1	1.31e-66	25	225	28	227
QQQ98385.1	1.31e-66	25	225	28	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.25e-33	52	226	22	199	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.76e-33	52	226	22	199	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.57e-32	41	212	48	233	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.74e-32	41	212	12	197	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.79e-32	41	212	13	198	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	2.48e-41	41	218	38	213	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
P40750	4.75e-41	38	231	64	256	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
O87579	9.33e-39	52	216	70	233	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
P0A0Z6	1.74e-38	52	216	70	233	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=mrcA PE=3 SV=1
P0A0Z5	1.74e-38	52	216	70	233	Penicillin-binding protein 1A OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.965070	0.023777	0.010257	0.000128	0.000065	0.000716

TMHMM  Annotations     

start	end
7	24